(data stored in ACNUC7421 zone)

EMBL: CP001349.PE352

CP001349.PE352       Location/Qualifiers
FT   CDS             complement(404677..405489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0361"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: met:M446_2248
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55404"
FT                   /db_xref="GOA:B8IB11"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB11"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ACL55404.1"
FT                   /translation="MPSSVDARALLPQVRATVREAALLALPFFNVGERTSARVWSKSGG
FT                   SPVTEADVAVDTFLKIRLSELAPGAAWLSEETRDDPVRLDHDLVWIVDPIDGTRAFLSG
FT                   DPDWSIAIALLSGGEPVLGIVAAPVTGLVYEAVVGQGARKNGEPIRVTAPESLAGARVA
FT                   GPKPMVDHLERNLGLGGTPDALIRLRRIPSLALRVARVAEGLVDVGLISSDARDWDLAG
FT                   ADLILREAGGVVLDLAGRAPAYNRREPVHGELVAAPRAVQETLLAAMR"
     MPSSVDARAL LPQVRATVRE AALLALPFFN VGERTSARVW SKSGGSPVTE ADVAVDTFLK        60
     IRLSELAPGA AWLSEETRDD PVRLDHDLVW IVDPIDGTRA FLSGDPDWSI AIALLSGGEP       120
     VLGIVAAPVT GLVYEAVVGQ GARKNGEPIR VTAPESLAGA RVAGPKPMVD HLERNLGLGG       180
     TPDALIRLRR IPSLALRVAR VAEGLVDVGL ISSDARDWDL AGADLILREA GGVVLDLAGR       240
     APAYNRREPV HGELVAAPRA VQETLLAAMR                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page