(data stored in ACNUC7421 zone)

EMBL: CP001349.PE353

CP001349.PE353       Location/Qualifiers
FT   CDS             405848..406369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55405"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB12"
FT                   /inference="similar to AA sequence:KEGG:M446_2247"
FT                   /protein_id="ACL55405.1"
FT                   /translation="MVTRIHSTNRQTDSRKGDGLLPILHRGPVQVEPSPLPIVGRMPGA
FT                   GRAASVALCLDAEASDAAGEDRFALLLLDKDGDPLMQLGTYGDADVVAVWRRLGAETGL
FT                   PLLVIQEDGAVTPLGAQLGRVKLGAVRIRRRHGLLSGRRPRFLCRRKTGRLPLRPAVHR
FT                   DEDPLTDHGL"
     MVTRIHSTNR QTDSRKGDGL LPILHRGPVQ VEPSPLPIVG RMPGAGRAAS VALCLDAEAS        60
     DAAGEDRFAL LLLDKDGDPL MQLGTYGDAD VVAVWRRLGA ETGLPLLVIQ EDGAVTPLGA       120
     QLGRVKLGAV RIRRRHGLLS GRRPRFLCRR KTGRLPLRPA VHRDEDPLTD HGL              173
//

If you have problems or comments...

PBIL Back to PBIL home page