(data stored in ACNUC7421 zone)

EMBL: CP001349.PE354

CP001349.PE354       Location/Qualifiers
FT   CDS             complement(406375..407349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0363"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: met:M446_2246
FT                   4-hydroxybenzoate polyprenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55406"
FT                   /db_xref="GOA:B8IB13"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB13"
FT                   /inference="protein motif:TFAM:TIGR01474"
FT                   /protein_id="ACL55406.1"
FT                   /translation="MRILPKATGRKATGGPDRPVADAVSGHWVDRHAPASWRPYLRLAR
FT                   IERPIGWWLLLLPCWWSASLAAIAAGRVGPDLWHLGLFLIGAVAMRGAGSTYNDIADRD
FT                   LDARVERTRLRPLPSGRLRVRHALAFLVAQALIGLAVLLQFNRFAVVVGLFSLAPVAIY
FT                   PFMKRVMPVPQLVLGLAFAWGALMGWAALIGRLDAPALWLYAGAIAWVIGYDTIYAVQD
FT                   IEDDEIAGIKSSARFFGSQVRGAVAACFVAAVGCIAIALALAGAGLPGFLGLALFGAHL
FT                   GWQVRRLDPRNGAAALRLFRSNRDAGLILFAGLALDALWQGLA"
     MRILPKATGR KATGGPDRPV ADAVSGHWVD RHAPASWRPY LRLARIERPI GWWLLLLPCW        60
     WSASLAAIAA GRVGPDLWHL GLFLIGAVAM RGAGSTYNDI ADRDLDARVE RTRLRPLPSG       120
     RLRVRHALAF LVAQALIGLA VLLQFNRFAV VVGLFSLAPV AIYPFMKRVM PVPQLVLGLA       180
     FAWGALMGWA ALIGRLDAPA LWLYAGAIAW VIGYDTIYAV QDIEDDEIAG IKSSARFFGS       240
     QVRGAVAACF VAAVGCIAIA LALAGAGLPG FLGLALFGAH LGWQVRRLDP RNGAAALRLF       300
     RSNRDAGLIL FAGLALDALW QGLA                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page