(data stored in ACNUC7421 zone)

EMBL: CP001349.PE355

CP001349.PE355       Location/Qualifiers
FT   CDS             complement(407346..407825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0364"
FT                   /product="putative signal peptide"
FT                   /note="KEGG: mrd:Mrad2831_5383 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55407"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB14"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5383"
FT                   /protein_id="ACL55407.1"
FT                   /translation="MVRMNKRAVAVLAAGLVGAVSIGGAARAQSTDCTAIQKTLTERKD
FT                   IVAKVNSASKSKNKLTPAQACSLFTRLQANGAEGLKWISANKDWCSIPDSFAEGFKADH
FT                   TKVIGLRGKICHAAQQQAVLEKRARAQAQNGGGGGGGLLGGPGLSGSYKLPQGAL"
     MVRMNKRAVA VLAAGLVGAV SIGGAARAQS TDCTAIQKTL TERKDIVAKV NSASKSKNKL        60
     TPAQACSLFT RLQANGAEGL KWISANKDWC SIPDSFAEGF KADHTKVIGL RGKICHAAQQ       120
     QAVLEKRARA QAQNGGGGGG GLLGGPGLSG SYKLPQGAL                              159
//

If you have problems or comments...

PBIL Back to PBIL home page