(data stored in ACNUC7421 zone)

EMBL: CP001349.PE356

CP001349.PE356       Location/Qualifiers
FT   CDS             408044..408847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0365"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   met:M446_2244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55408"
FT                   /db_xref="GOA:B8IB15"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB15"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACL55408.1"
FT                   /translation="MAAYDFSAPRLFLDLPMREGMRHSLDRAQANYLLGVLRRGEGDGV
FT                   LVFNGRDGEWRAEIQPTGRKAGDLILREQTRPQTPPGNLHYLFAPLKAARLDYVAQKAV
FT                   EMGASLIRPVITRRTQGDRIKLDRLRANAIEAAEQCGILTIPEIAEAAPLPAALSALEA
FT                   ERLLVFCDEDAPVADPIMTLRQAGAGREGNGGLPLAVVIGPEGGFTPEERALILDRPNT
FT                   VRLSLGPRILRADTAAVAVLALVQAVLGDGRGSGADGRDITAPVA"
     MAAYDFSAPR LFLDLPMREG MRHSLDRAQA NYLLGVLRRG EGDGVLVFNG RDGEWRAEIQ        60
     PTGRKAGDLI LREQTRPQTP PGNLHYLFAP LKAARLDYVA QKAVEMGASL IRPVITRRTQ       120
     GDRIKLDRLR ANAIEAAEQC GILTIPEIAE AAPLPAALSA LEAERLLVFC DEDAPVADPI       180
     MTLRQAGAGR EGNGGLPLAV VIGPEGGFTP EERALILDRP NTVRLSLGPR ILRADTAAVA       240
     VLALVQAVLG DGRGSGADGR DITAPVA                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page