(data stored in ACNUC7421 zone)

EMBL: CP001349.PE357

CP001349.PE357       Location/Qualifiers
FT   CDS             408930..410063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0366"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   met:M446_2243 glutamate--cysteine ligase GCS2"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55409"
FT                   /db_xref="GOA:B8IB16"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB16"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ACL55409.1"
FT                   /translation="MHADFAFCIEEDVFLNDAQKRDAARARVRDFLAVCRRDFPAARHD
FT                   LIEPRLIWTTPPLADLAQARRVLAELRGGIGALAATQGLAVMAAGTHPIALWSRVRPRD
FT                   TGARDRVQRDLQMVGSRTVVCGLSIRVGLPDGVSRIDVMNRIQPFLPLLLALSTSSPFW
FT                   QAQRTGLLGYRLAASRELPRSGLPPYFADEADHARYLDALMRAGAIDDLGHVWWVIRPA
FT                   PQGNALDLRIADSCTRLDDTLAIAALTRCLVRRLARDPALNRDLTGATHAITAENCWRA
FT                   QRYGIHGSFMAEEEAAMPVKEVLARTLALLAEDAAALGCTAELDLARWIVARGTSADRQ
FT                   LALFTEAQGRGLTQREALCTVVDWLSAETVGAAPTRH"
     MHADFAFCIE EDVFLNDAQK RDAARARVRD FLAVCRRDFP AARHDLIEPR LIWTTPPLAD        60
     LAQARRVLAE LRGGIGALAA TQGLAVMAAG THPIALWSRV RPRDTGARDR VQRDLQMVGS       120
     RTVVCGLSIR VGLPDGVSRI DVMNRIQPFL PLLLALSTSS PFWQAQRTGL LGYRLAASRE       180
     LPRSGLPPYF ADEADHARYL DALMRAGAID DLGHVWWVIR PAPQGNALDL RIADSCTRLD       240
     DTLAIAALTR CLVRRLARDP ALNRDLTGAT HAITAENCWR AQRYGIHGSF MAEEEAAMPV       300
     KEVLARTLAL LAEDAAALGC TAELDLARWI VARGTSADRQ LALFTEAQGR GLTQREALCT       360
     VVDWLSAETV GAAPTRH                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page