(data stored in ACNUC7421 zone)

EMBL: CP001349.PE358

CP001349.PE358       Location/Qualifiers
FT   CDS             complement(410361..410750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55410"
FT                   /db_xref="InterPro:IPR022254"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB17"
FT                   /inference="similar to AA sequence:KEGG:M446_2242"
FT                   /protein_id="ACL55410.1"
FT                   /translation="MDIAVEKVCEFILRVRALDVKEGPTDPDSGSNPTDDGSRDVLNED
FT                   PDDATEDELREVIAGLNDDERAELVALLYVGRGDMEPGEFADAVRLAREREAAGTSTAD
FT                   YLLGIPNVGDLLAEGLEAMGLRCEV"
     MDIAVEKVCE FILRVRALDV KEGPTDPDSG SNPTDDGSRD VLNEDPDDAT EDELREVIAG        60
     LNDDERAELV ALLYVGRGDM EPGEFADAVR LAREREAAGT STADYLLGIP NVGDLLAEGL       120
     EAMGLRCEV                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page