(data stored in ACNUC7421 zone)

EMBL: CP001349.PE359

CP001349.PE359       Location/Qualifiers
FT   CDS             410874..411590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0368"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540; KEGG:
FT                   met:M446_2241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55411"
FT                   /db_xref="GOA:B8IB18"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB18"
FT                   /inference="protein motif:PFAM:PF04401"
FT                   /protein_id="ACL55411.1"
FT                   /translation="MLISAAFAALRQVLSPPLRRILWKSLGLTVGLLVLVWFALTRLID
FT                   TLLIGHPISAQYPIVNSFAFFLAGAGLFVALAYILPPVSILVAGYFLDDAAEVVERTDF
FT                   PDEVPGRAMALGQALLYSLRFAGLALVVNLVALALFFVPGVNLIAFFGANTYLLGREYF
FT                   EMAAARFRPLPEAQAMRRHYSATVMAAGALLAGLMVVPVLNLLTPLFGIALMVHVHKGL
FT                   SRERLLAAPQARPPIR"
     MLISAAFAAL RQVLSPPLRR ILWKSLGLTV GLLVLVWFAL TRLIDTLLIG HPISAQYPIV        60
     NSFAFFLAGA GLFVALAYIL PPVSILVAGY FLDDAAEVVE RTDFPDEVPG RAMALGQALL       120
     YSLRFAGLAL VVNLVALALF FVPGVNLIAF FGANTYLLGR EYFEMAAARF RPLPEAQAMR       180
     RHYSATVMAA GALLAGLMVV PVLNLLTPLF GIALMVHVHK GLSRERLLAA PQARPPIR         238
//

If you have problems or comments...

PBIL Back to PBIL home page