(data stored in ACNUC7421 zone)

EMBL: CP001349.PE36

CP001349.PE36        Location/Qualifiers
FT   CDS             complement(37646..38647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0037"
FT                   /product="glycosyl transferase family 4"
FT                   /note="PFAM: glycosyl transferase family 4; KEGG:
FT                   met:M446_0035 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55088"
FT                   /db_xref="GOA:B8IT26"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT26"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ACL55088.1"
FT                   /translation="MSLAPLIAVPLAALAAAALILALHPLLVRYALARPNARSSHTVPT
FT                   PQGGGIAVIAAALAVAGSLWPSPFGIEAAALCLAALGLGAVGAVDDIKPLPALPRLVLQ
FT                   AVAVGGVIAASGPRLWPDLPLGLEWGLSLLAGLWFVNLVNFMDGLDWMTVAETAPVLTA
FT                   LLVFGLAGFLPPEPTLAAGALLGGVLGFAPFNRPVARLFLGDVGSLPIGLILAWLLYRL
FT                   AGEGGLAAAILLPLYYLADATLTLIRRLLAGEPVWQAHRTHYYQRATANGHRVPAVIGA
FT                   VFVLNGALALIAGATLVWPSWPVITAALALGAGLVAALLRAFATPRALTVTA"
     MSLAPLIAVP LAALAAAALI LALHPLLVRY ALARPNARSS HTVPTPQGGG IAVIAAALAV        60
     AGSLWPSPFG IEAAALCLAA LGLGAVGAVD DIKPLPALPR LVLQAVAVGG VIAASGPRLW       120
     PDLPLGLEWG LSLLAGLWFV NLVNFMDGLD WMTVAETAPV LTALLVFGLA GFLPPEPTLA       180
     AGALLGGVLG FAPFNRPVAR LFLGDVGSLP IGLILAWLLY RLAGEGGLAA AILLPLYYLA       240
     DATLTLIRRL LAGEPVWQAH RTHYYQRATA NGHRVPAVIG AVFVLNGALA LIAGATLVWP       300
     SWPVITAALA LGAGLVAALL RAFATPRALT VTA                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page