(data stored in ACNUC7421 zone)

EMBL: CP001349.PE360

CP001349.PE360       Location/Qualifiers
FT   CDS             complement(411606..412751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0369"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: met:M446_2240 NADH dehydrogenase
FT                   (ubiquinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55412"
FT                   /db_xref="GOA:B8IB19"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB19"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55412.1"
FT                   /translation="MPDPVGPTRPASQLVTVFGGSGFLGRHVVRALAKRGYRIRVAVRR
FT                   PDLAQFLQPLGRVGQIVAVQANLRDAASVTRAVEHADVVINLVGILQESGNQSFQRLQA
FT                   DGAGLVARAATAIGARMIHVSAIGADPESPSAYARTKAAGEAKVLAACPEAVIFRPSII
FT                   FGPGDSFFNRFAGLARLMPVLPLAGAGTRMQPVFVGDVAEAIARTVDGKAKPGTIYELG
FT                   GPEILTLQQLVEYTLQVTKRRRIVLPLPGPAARLQARALEIADTLTLGLLPDSLKLTRD
FT                   QVILLERDNVVSEAAKAEGRSFEALGLVPTAVEAVVPGYLWRFRKAGQFSTGRGSPGMA
FT                   AVPDVIAPNPMDEHSAHHPDEAGGPAVGQKGAGTDQAPGMH"
     MPDPVGPTRP ASQLVTVFGG SGFLGRHVVR ALAKRGYRIR VAVRRPDLAQ FLQPLGRVGQ        60
     IVAVQANLRD AASVTRAVEH ADVVINLVGI LQESGNQSFQ RLQADGAGLV ARAATAIGAR       120
     MIHVSAIGAD PESPSAYART KAAGEAKVLA ACPEAVIFRP SIIFGPGDSF FNRFAGLARL       180
     MPVLPLAGAG TRMQPVFVGD VAEAIARTVD GKAKPGTIYE LGGPEILTLQ QLVEYTLQVT       240
     KRRRIVLPLP GPAARLQARA LEIADTLTLG LLPDSLKLTR DQVILLERDN VVSEAAKAEG       300
     RSFEALGLVP TAVEAVVPGY LWRFRKAGQF STGRGSPGMA AVPDVIAPNP MDEHSAHHPD       360
     EAGGPAVGQK GAGTDQAPGM H                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page