(data stored in ACNUC7421 zone)

EMBL: CP001349.PE361

CP001349.PE361       Location/Qualifiers
FT   CDS             complement(412943..413578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55413"
FT                   /db_xref="InterPro:IPR025833"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB20"
FT                   /inference="similar to AA sequence:KEGG:M446_2239"
FT                   /protein_id="ACL55413.1"
FT                   /translation="MTRLALPRAGGALAAVAFALLFVVQAAPAVKVALDQSRRLEAGRA
FT                   VLLAAATRDPRDLFRGEYSVLSYEAGQPAGLSASEDLARACGPEPGCRLPGGMTVYVTL
FT                   TEGADGLHHAAAIAATKPTGTNPFLRGTVRFGSLTRDGGRSPCAGLCFSGAVDYGLERW
FT                   YGPQGVPADLDRLDRGRIRIRARVDGEGTAILDALLVDGREVARTPRL"
     MTRLALPRAG GALAAVAFAL LFVVQAAPAV KVALDQSRRL EAGRAVLLAA ATRDPRDLFR        60
     GEYSVLSYEA GQPAGLSASE DLARACGPEP GCRLPGGMTV YVTLTEGADG LHHAAAIAAT       120
     KPTGTNPFLR GTVRFGSLTR DGGRSPCAGL CFSGAVDYGL ERWYGPQGVP ADLDRLDRGR       180
     IRIRARVDGE GTAILDALLV DGREVARTPR L                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page