(data stored in ACNUC7421 zone)

EMBL: CP001349.PE362

CP001349.PE362       Location/Qualifiers
FT   CDS             complement(413575..414885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0371"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: met:M446_2238 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55414"
FT                   /db_xref="GOA:B8IB21"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB21"
FT                   /inference="similar to AA sequence:KEGG:M446_2238"
FT                   /protein_id="ACL55414.1"
FT                   /translation="MTDMPFSYRERVLRDIRSWAARGLIDLAQQRRLEEEVRRGSDLGG
FT                   LQVALGIAAALLVGTAALAFVASNWAAMPPFARLLLLIAADALVVGLAGLAAFRQRASG
FT                   DPTLRHIADALAALSVAVSAAALALMGQTFHLPADLSGFALTVAVVGTVTALVARSGGA
FT                   AGIAAAALVVTAWPDLDEFGPARAVSWPGWACLGLLAAGQLSGWIPARSAGFLVLLIPV
FT                   ATEIAVVGDGEPRVDAGRLVLLAFGVIALAQVLRLVPALPDRVASRLSRLAGAAAGLLL
FT                   IGLLIRAAGVTGWPSATATPSAPRLLLMAVWIGLVLLPPRLRGEPLPVGLLILAAAALV
FT                   PLCLGGPAPPILGEAGWAVWTVLLPILAVAVAARLDHRRTLYAGSLAACLVIALALMML
FT                   ADNLIGVSLHLLVAGALAALAVAAIRRLPRHAAPSWP"
     MTDMPFSYRE RVLRDIRSWA ARGLIDLAQQ RRLEEEVRRG SDLGGLQVAL GIAAALLVGT        60
     AALAFVASNW AAMPPFARLL LLIAADALVV GLAGLAAFRQ RASGDPTLRH IADALAALSV       120
     AVSAAALALM GQTFHLPADL SGFALTVAVV GTVTALVARS GGAAGIAAAA LVVTAWPDLD       180
     EFGPARAVSW PGWACLGLLA AGQLSGWIPA RSAGFLVLLI PVATEIAVVG DGEPRVDAGR       240
     LVLLAFGVIA LAQVLRLVPA LPDRVASRLS RLAGAAAGLL LIGLLIRAAG VTGWPSATAT       300
     PSAPRLLLMA VWIGLVLLPP RLRGEPLPVG LLILAAAALV PLCLGGPAPP ILGEAGWAVW       360
     TVLLPILAVA VAARLDHRRT LYAGSLAACL VIALALMMLA DNLIGVSLHL LVAGALAALA       420
     VAAIRRLPRH AAPSWP                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page