(data stored in ACNUC7421 zone)

EMBL: CP001349.PE363

CP001349.PE363       Location/Qualifiers
FT   CDS             415221..416303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0373"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: nha:Nham_4120 transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55415"
FT                   /db_xref="GOA:B8IB22"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB22"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL55415.1"
FT                   /translation="MLSGHKHREGAAVKYYAGLDVSLEETAICVVDDTGRIVREARAAS
FT                   EPGALVQALNQIGLPLERIGLEACSLTAWLHDGLREAGLPAICIETRQANAAMKTMPNK
FT                   TDRNDARALAQIMRTGWFRQVHVKSRQCRLWRSLLVARRTVLNEMRSIENVVRGILREA
FT                   GLKLGTPGRAAFAGRVRELAEGVPLMTQLVEPLLEVLASMLTALAGLTKQVMDLVKKEA
FT                   VCQRLMSVPGVGPITALAFRATIDRPDRFRRSRDVGAHLGLTPARYQSGETDIQGKISR
FT                   CGDELARTALYEAAHTLLVRSQKWSSLRAWGMKIARRRGMARARVAVARKLAVILHRMW
FT                   SDGTAFRWGKEPAEGATLAG"
     MLSGHKHREG AAVKYYAGLD VSLEETAICV VDDTGRIVRE ARAASEPGAL VQALNQIGLP        60
     LERIGLEACS LTAWLHDGLR EAGLPAICIE TRQANAAMKT MPNKTDRNDA RALAQIMRTG       120
     WFRQVHVKSR QCRLWRSLLV ARRTVLNEMR SIENVVRGIL REAGLKLGTP GRAAFAGRVR       180
     ELAEGVPLMT QLVEPLLEVL ASMLTALAGL TKQVMDLVKK EAVCQRLMSV PGVGPITALA       240
     FRATIDRPDR FRRSRDVGAH LGLTPARYQS GETDIQGKIS RCGDELARTA LYEAAHTLLV       300
     RSQKWSSLRA WGMKIARRRG MARARVAVAR KLAVILHRMW SDGTAFRWGK EPAEGATLAG       360
//

If you have problems or comments...

PBIL Back to PBIL home page