(data stored in ACNUC7421 zone)

EMBL: CP001349.PE364

CP001349.PE364       Location/Qualifiers
FT   CDS             complement(416795..418297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0374"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: met:M446_2236 amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55416"
FT                   /db_xref="GOA:B8IB23"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB23"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACL55416.1"
FT                   /translation="MSLHTETLIIGAGPAGLTAAYLLAKAGRQVTVLERDPLRVGGISR
FT                   TVEYNGYLFDIGGHRFFSKSKEVVDLWNEILPDDFIERPRLSRIYYKGRYYAYPLKAFE
FT                   ALRNLGLWQSAACIASYLYARARPVREPRSFHDWVRNQFGERLFSIFFKTYTEKVWGLS
FT                   CDAISADWAAQRIKGLDLGAAIRDALTRSLGLRGRPKAGEPVIKTLIESFRYPRRGPGM
FT                   MWEAAAAAVRDGGGRVLLGLGVESLSFDPGCGLWTIGARRQDGSRETFTARHVVSSAAI
FT                   QDLVAALRPAPLSTFHARALGYRDFITVALIARGAEDFLDNWIYIHDPSVKVGRVQNFR
FT                   SWSPEMVPDPTYTCLGLEYFCFEGDGLWNAADSELVDLAKREIAQIGLIRPEDVVDACV
FT                   VRQPKAYPVYDEAYRDNVAAIRRDLETTYPTLHLVGRNGMHKYNNQDHAMMTAMLTVRN
FT                   ILAGQRLYDVWSVNEDAEYAEAGLSGAREALRSERLVPRKVA"
     MSLHTETLII GAGPAGLTAA YLLAKAGRQV TVLERDPLRV GGISRTVEYN GYLFDIGGHR        60
     FFSKSKEVVD LWNEILPDDF IERPRLSRIY YKGRYYAYPL KAFEALRNLG LWQSAACIAS       120
     YLYARARPVR EPRSFHDWVR NQFGERLFSI FFKTYTEKVW GLSCDAISAD WAAQRIKGLD       180
     LGAAIRDALT RSLGLRGRPK AGEPVIKTLI ESFRYPRRGP GMMWEAAAAA VRDGGGRVLL       240
     GLGVESLSFD PGCGLWTIGA RRQDGSRETF TARHVVSSAA IQDLVAALRP APLSTFHARA       300
     LGYRDFITVA LIARGAEDFL DNWIYIHDPS VKVGRVQNFR SWSPEMVPDP TYTCLGLEYF       360
     CFEGDGLWNA ADSELVDLAK REIAQIGLIR PEDVVDACVV RQPKAYPVYD EAYRDNVAAI       420
     RRDLETTYPT LHLVGRNGMH KYNNQDHAMM TAMLTVRNIL AGQRLYDVWS VNEDAEYAEA       480
     GLSGAREALR SERLVPRKVA                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page