(data stored in ACNUC7421 zone)

EMBL: CP001349.PE365

CP001349.PE365       Location/Qualifiers
FT   CDS             418446..420260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55417"
FT                   /db_xref="GOA:B8IB24"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB24"
FT                   /inference="similar to AA sequence:KEGG:M446_2235"
FT                   /protein_id="ACL55417.1"
FT                   /translation="MPSTALLAAGPSPAPRSLFESRPVLWGLVALGLAGAFGLSHMLPV
FT                   LRDLVLPDTDDAMRLVQVRDLLAGQSWFDVGQHRLLPPGGSSMHWSRLVDLPIAALILI
FT                   LRPFAGAQADAVAAALWPPLLFGLYSAMLFVGARRLSGERAALLALFAATQTPLLTSLF
FT                   APGRIDHHNVQVCAVLGLALCLMRPAPGWREGAAAGALAALSLAVGLETLPFIAAAGLL
FT                   VTGAWILSGERALGAFLGFAAALAAGSAALFGLGTTPAHWGAPACDALSPPWLWVAGSA
FT                   GATALAAAGLRRRLLRPETRLALAALGGLAIAGGFAAIAPACLDGPFAGMPETIRQGWL
FT                   LKVREMLPLWRNLPEFPGEILSAFMPLLVGALAATVLALRGPAAQRRPQGILAAALWLG
FT                   VGLGTLQFRGLYVASGFVALAAGAVLDRGLAMLRTPGAGHAARAATLAAGLGLIGKLWL
FT                   AGAAVPSLPSPTKPQAGNGESTWSHCTGRSAMAALAAQPPGTVLAPIDLGPFLLLHTPH
FT                   GVVAAPYHRNTVGLAAALEGFRDAAALRRVAAERQVAYIAVCPPSEGADGGAPLIGDLA
FT                   RRKVAPSWLEPIPMPDSPLKIWRVRPQP"
     MPSTALLAAG PSPAPRSLFE SRPVLWGLVA LGLAGAFGLS HMLPVLRDLV LPDTDDAMRL        60
     VQVRDLLAGQ SWFDVGQHRL LPPGGSSMHW SRLVDLPIAA LILILRPFAG AQADAVAAAL       120
     WPPLLFGLYS AMLFVGARRL SGERAALLAL FAATQTPLLT SLFAPGRIDH HNVQVCAVLG       180
     LALCLMRPAP GWREGAAAGA LAALSLAVGL ETLPFIAAAG LLVTGAWILS GERALGAFLG       240
     FAAALAAGSA ALFGLGTTPA HWGAPACDAL SPPWLWVAGS AGATALAAAG LRRRLLRPET       300
     RLALAALGGL AIAGGFAAIA PACLDGPFAG MPETIRQGWL LKVREMLPLW RNLPEFPGEI       360
     LSAFMPLLVG ALAATVLALR GPAAQRRPQG ILAAALWLGV GLGTLQFRGL YVASGFVALA       420
     AGAVLDRGLA MLRTPGAGHA ARAATLAAGL GLIGKLWLAG AAVPSLPSPT KPQAGNGEST       480
     WSHCTGRSAM AALAAQPPGT VLAPIDLGPF LLLHTPHGVV AAPYHRNTVG LAAALEGFRD       540
     AAALRRVAAE RQVAYIAVCP PSEGADGGAP LIGDLARRKV APSWLEPIPM PDSPLKIWRV       600
     RPQP                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page