(data stored in ACNUC7421 zone)

EMBL: CP001349.PE366

CP001349.PE366       Location/Qualifiers
FT   CDS             420257..420790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55418"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB25"
FT                   /inference="similar to AA sequence:KEGG:M446_2234"
FT                   /protein_id="ACL55418.1"
FT                   /translation="MRQRAPIAILLAALGLTLLALGGLVVARGAEPGGIEEAWMLLFGA
FT                   PDLGPVDFEHLRRSGADGLACPPDICPGAHADIVPPTLPIAGARLREIVRRVAQGEPDT
FT                   VLVFSDRWGEQDRYVARSRIMRFPDTVTVEIVGRGEGASTLALYSRSQIGAGLFSDNRA
FT                   RLARWLDGVKDAAR"
     MRQRAPIAIL LAALGLTLLA LGGLVVARGA EPGGIEEAWM LLFGAPDLGP VDFEHLRRSG        60
     ADGLACPPDI CPGAHADIVP PTLPIAGARL REIVRRVAQG EPDTVLVFSD RWGEQDRYVA       120
     RSRIMRFPDT VTVEIVGRGE GASTLALYSR SQIGAGLFSD NRARLARWLD GVKDAAR          177
//

If you have problems or comments...

PBIL Back to PBIL home page