(data stored in ACNUC7421 zone)

EMBL: CP001349.PE367

CP001349.PE367       Location/Qualifiers
FT   CDS             420787..422160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0377"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: met:M446_2233 amine
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55419"
FT                   /db_xref="GOA:B8IB26"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB26"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACL55419.1"
FT                   /translation="MRAPDHARFRPHTVPPLAPLPREPDVVVVGAGAAGIAAARRLRAR
FT                   GLSVAVLEARDRVGGRTFTTTLRGHAVDLGAHWLHAGPINPLVAFGVARGEPLRRAAQE
FT                   SHLMVGRRKGRPDEAAAYGRAFALADRAMTGGAGRDGPDRPAAFALPPGLGPWGRRVAL
FT                   VHGLVSGRPLAEVSLHDFPSMEYGDNFFIAGGYGAYLARLARALPITLGAPVRVIDWSG
FT                   AGVAVDVGGRGRIRARAVLVTAPMMVLQDEAAFRFSPPLPPGIRAAIDGFLPGIYEHVV
FT                   LHWPSAPFRGRDRLAGLTGGRRQPPGLLTRVDGTAFHYFELDRPMTAALDAAGAGPDGA
FT                   RRLTRAVLTDHVGSGRLGDLAIPAVSEWRLDPWSRGSWAVVPPGHAPARDALKEPVGER
FT                   IWFAGEALSRRQWGTAGGAYEEGERAAEAIAAALAGSRAGEAKRAREPRDPLSRAGEG"
     MRAPDHARFR PHTVPPLAPL PREPDVVVVG AGAAGIAAAR RLRARGLSVA VLEARDRVGG        60
     RTFTTTLRGH AVDLGAHWLH AGPINPLVAF GVARGEPLRR AAQESHLMVG RRKGRPDEAA       120
     AYGRAFALAD RAMTGGAGRD GPDRPAAFAL PPGLGPWGRR VALVHGLVSG RPLAEVSLHD       180
     FPSMEYGDNF FIAGGYGAYL ARLARALPIT LGAPVRVIDW SGAGVAVDVG GRGRIRARAV       240
     LVTAPMMVLQ DEAAFRFSPP LPPGIRAAID GFLPGIYEHV VLHWPSAPFR GRDRLAGLTG       300
     GRRQPPGLLT RVDGTAFHYF ELDRPMTAAL DAAGAGPDGA RRLTRAVLTD HVGSGRLGDL       360
     AIPAVSEWRL DPWSRGSWAV VPPGHAPARD ALKEPVGERI WFAGEALSRR QWGTAGGAYE       420
     EGERAAEAIA AALAGSRAGE AKRAREPRDP LSRAGEG                                457
//

If you have problems or comments...

PBIL Back to PBIL home page