(data stored in ACNUC7421 zone)

EMBL: CP001349.PE368

CP001349.PE368       Location/Qualifiers
FT   CDS             complement(422329..423333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0378"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /EC_number="1.1.1.26"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: met:M446_2232 glyoxylate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55420"
FT                   /db_xref="GOA:B8IB27"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB27"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACL55420.1"
FT                   /translation="MSSLKRKPLVVVTRRLPDVVETRMRELFDTRLNHDDKPLSPAALV
FT                   QAVQEADVLVPTLTDEIDASLLAQAGPQLRLIANFGNGVDHIDVDSALQRGITVTNTPG
FT                   VLTEDTADMTMALILAVARRITEGARIIPEESWTTGWSPTWMLGRRITGKRLGIVGMGR
FT                   IGQALARRARAFGLSIHYHNRRRVSARTEAELEATYWESLDQMLARVDIVSVNCPHTPA
FT                   TYHLLSARRLKLLKPEAVVVNTARGEVIDETALARLIEVGDIAGAGLDVFEQEPAVSPR
FT                   LVKLAKAGKVVLLPHMGSATHESRIDMGEKVIINIKTFMDGHRPPDRVLPSML"
     MSSLKRKPLV VVTRRLPDVV ETRMRELFDT RLNHDDKPLS PAALVQAVQE ADVLVPTLTD        60
     EIDASLLAQA GPQLRLIANF GNGVDHIDVD SALQRGITVT NTPGVLTEDT ADMTMALILA       120
     VARRITEGAR IIPEESWTTG WSPTWMLGRR ITGKRLGIVG MGRIGQALAR RARAFGLSIH       180
     YHNRRRVSAR TEAELEATYW ESLDQMLARV DIVSVNCPHT PATYHLLSAR RLKLLKPEAV       240
     VVNTARGEVI DETALARLIE VGDIAGAGLD VFEQEPAVSP RLVKLAKAGK VVLLPHMGSA       300
     THESRIDMGE KVIINIKTFM DGHRPPDRVL PSML                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page