(data stored in ACNUC7421 zone)

EMBL: CP001349.PE369

CP001349.PE369       Location/Qualifiers
FT   CDS             423623..424186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0379"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; KEGG:
FT                   met:M446_2231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55421"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB28"
FT                   /inference="protein motif:PFAM:PF06347"
FT                   /protein_id="ACL55421.1"
FT                   /translation="MPLARAGALLIALMAAWAALASLPASAAPKLPETGLGPVSGLPMP
FT                   RYVSLKTDRVNLREGPSKDHRTLWVFQRAGLPVEIVSEFETWRRIRDSEGTEGWVLHSL
FT                   LSGRRTAVVLAQGDKAAPVPLYAEPEGRGGVVAQLQAGVIGSIKSCSGTWCRLIVALPQ
FT                   KRGDVDGYLRQDRLWGVYPNEKVE"
     MPLARAGALL IALMAAWAAL ASLPASAAPK LPETGLGPVS GLPMPRYVSL KTDRVNLREG        60
     PSKDHRTLWV FQRAGLPVEI VSEFETWRRI RDSEGTEGWV LHSLLSGRRT AVVLAQGDKA       120
     APVPLYAEPE GRGGVVAQLQ AGVIGSIKSC SGTWCRLIVA LPQKRGDVDG YLRQDRLWGV       180
     YPNEKVE                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page