(data stored in ACNUC7421 zone)

EMBL: CP001349.PE37

CP001349.PE37        Location/Qualifiers
FT   CDS             complement(38939..41011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0038"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; cobalamin B12-binding
FT                   domain protein; KEGG: met:M446_0036 methylmalonyl-CoA
FT                   mutase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55089"
FT                   /db_xref="GOA:B8IT27"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT27"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ACL55089.1"
FT                   /translation="MPPPRGLRNTRDEGAMGDQAMGTAQRDKPWIIRTYAGHSTAAESN
FT                   ALYRRNLAKGQTGLSVAFDLPTQTGYDPDHELARGEVGKVGVSIAHLGDMRTLFKDIPL
FT                   AQMNTSMTINATAPWLLSLYLAVAEEQGAPISVLQGTTQNDIIKEYLSRGTYVFPPAPS
FT                   LRLTKDVILFTTKQVPKWNPMNVCSYHLQEAGATPVQELSYALAIAIAVLDTVRADPDF
FT                   DEASFSEVVGRISFFVNAGLRFITEICKMRAFCDLWDEITRDRYGITDPKKRIFRYGVQ
FT                   VNSLGLTEQQPENNVHRILIEMLAVTLSKRARARAVQLPAWNEALGLPRPWDQQWSMRM
FT                   QQILAYETDLLEFDDIFDGSKVIDAKVEALKAETRSELERIGALGGAVAAVETGALKRA
FT                   LVESNARRIAAIERGEQVVVGVNRFETGEPSPLTAGDGAIFTVSETVEMEAQQRIRAWR
FT                   AERDAKAVARALDDLEAAARSGANIMPVSIACAKAGVTTGEWGERLREVFGEYRAPTGV
FT                   TPETTTSGAAEEARLLIADLGERLGETPKLVVGKPGLDGHSNGAEQIALRARDVGFDVT
FT                   YDGIRQTPDEIVAKARERGAHVIGLSILSGSHVPLVREVKARLRREGLDHVPVVVGGII
FT                   SPEDELVLKNMGVAAVYTPKDYAMDTIMVGLAKVVEKALARREADSALPNREQVF"
     MPPPRGLRNT RDEGAMGDQA MGTAQRDKPW IIRTYAGHST AAESNALYRR NLAKGQTGLS        60
     VAFDLPTQTG YDPDHELARG EVGKVGVSIA HLGDMRTLFK DIPLAQMNTS MTINATAPWL       120
     LSLYLAVAEE QGAPISVLQG TTQNDIIKEY LSRGTYVFPP APSLRLTKDV ILFTTKQVPK       180
     WNPMNVCSYH LQEAGATPVQ ELSYALAIAI AVLDTVRADP DFDEASFSEV VGRISFFVNA       240
     GLRFITEICK MRAFCDLWDE ITRDRYGITD PKKRIFRYGV QVNSLGLTEQ QPENNVHRIL       300
     IEMLAVTLSK RARARAVQLP AWNEALGLPR PWDQQWSMRM QQILAYETDL LEFDDIFDGS       360
     KVIDAKVEAL KAETRSELER IGALGGAVAA VETGALKRAL VESNARRIAA IERGEQVVVG       420
     VNRFETGEPS PLTAGDGAIF TVSETVEMEA QQRIRAWRAE RDAKAVARAL DDLEAAARSG       480
     ANIMPVSIAC AKAGVTTGEW GERLREVFGE YRAPTGVTPE TTTSGAAEEA RLLIADLGER       540
     LGETPKLVVG KPGLDGHSNG AEQIALRARD VGFDVTYDGI RQTPDEIVAK ARERGAHVIG       600
     LSILSGSHVP LVREVKARLR REGLDHVPVV VGGIISPEDE LVLKNMGVAA VYTPKDYAMD       660
     TIMVGLAKVV EKALARREAD SALPNREQVF                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page