(data stored in ACNUC7421 zone)

EMBL: CP001349.PE370

CP001349.PE370       Location/Qualifiers
FT   CDS             424204..424629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc01008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55422"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB29"
FT                   /inference="similar to AA sequence:KEGG:SMc01008"
FT                   /protein_id="ACL55422.1"
FT                   /translation="MTVPQEYVQASRDFERFLLAARDALGHATTHRTYATIYSVLLVFR
FT                   RHVSVRDGLRFATVLPPVLRAIFVSDWDPAEPVRDFADRETLTAEMLSVRGNHNVSPAD
FT                   AIAVVARVLRDHVDQEAYDRVLATLPEPARDYWRDAM"
     MTVPQEYVQA SRDFERFLLA ARDALGHATT HRTYATIYSV LLVFRRHVSV RDGLRFATVL        60
     PPVLRAIFVS DWDPAEPVRD FADRETLTAE MLSVRGNHNV SPADAIAVVA RVLRDHVDQE       120
     AYDRVLATLP EPARDYWRDA M                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page