(data stored in ACNUC7421 zone)

EMBL: CP001349.PE371

CP001349.PE371       Location/Qualifiers
FT   CDS             complement(424721..425215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0381"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: met:M446_2230
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55423"
FT                   /db_xref="GOA:B8IB30"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB30"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACL55423.1"
FT                   /translation="MNDLSPLHAVLSARTPAIHADGAAGQRRGCPLSELRDRLRRAGLR
FT                   PTRQRLSLGWLLFGKGDRHLTAEMLYDEAMRAKVPVSLATVYNTLHQFTEAGLLRQLAL
FT                   DGSKAYFDTNPSEHHHFFLEEEGQVLDMPDCGITVDALPQPPEGMEIAGVEVIVRLRRR
FT                   T"
     MNDLSPLHAV LSARTPAIHA DGAAGQRRGC PLSELRDRLR RAGLRPTRQR LSLGWLLFGK        60
     GDRHLTAEML YDEAMRAKVP VSLATVYNTL HQFTEAGLLR QLALDGSKAY FDTNPSEHHH       120
     FFLEEEGQVL DMPDCGITVD ALPQPPEGME IAGVEVIVRL RRRT                        164
//

If you have problems or comments...

PBIL Back to PBIL home page