(data stored in ACNUC7421 zone)

EMBL: CP001349.PE372

CP001349.PE372       Location/Qualifiers
FT   CDS             425454..426005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0382"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.59"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; KEGG: met:M446_2229
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55424"
FT                   /db_xref="GOA:B8IB31"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB31"
FT                   /inference="protein motif:TFAM:TIGR01749"
FT                   /protein_id="ACL55424.1"
FT                   /translation="MSADTPATDAQTRPSQFSYEDLLACGRGEMFGPGNAQLPLPPMLM
FT                   FDRIVSIGRDGGAHGKGHVRAELDVRPDLWFFPCHFQGDPVMPGCLGLDALWQMVGFFL
FT                   GWLGSPGRGRALGVGEVKFTDQVLPSVRKVVYGVDLKRVRQGRLVLGIADGWLEADGRR
FT                   IYEAQDLRVGLFQAAAPAGG"
     MSADTPATDA QTRPSQFSYE DLLACGRGEM FGPGNAQLPL PPMLMFDRIV SIGRDGGAHG        60
     KGHVRAELDV RPDLWFFPCH FQGDPVMPGC LGLDALWQMV GFFLGWLGSP GRGRALGVGE       120
     VKFTDQVLPS VRKVVYGVDL KRVRQGRLVL GIADGWLEAD GRRIYEAQDL RVGLFQAAAP       180
     AGG                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page