(data stored in ACNUC7421 zone)

EMBL: CP001349.PE373

CP001349.PE373       Location/Qualifiers
FT   CDS             426078..427304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0383"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: met:M446_2228
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55425"
FT                   /db_xref="GOA:B8IB32"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB32"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ACL55425.1"
FT                   /translation="MRRVAITGMGIVSSIGNNTQEVLASLREARSGITHAESFAAHGFR
FT                   CQVQGAPTLDPESVVDRRAMRFHGGGTAWNHVAMEQAIRDAGLEEREVSHERTGIIMGS
FT                   GGPSTRAIVEAADIARAKGPKRVGPFAVPKAMCSTASATLATWFKIKGVNYSISSACAT
FT                   SNHCIGNAAEIIQAGRQDIIFAGGCEELDWTLSVLFDAMGAMSAKYNDTPARASRAYDA
FT                   GRDGFVIAGGAGVLVLEELEHAKARGARIYGEIAGYGATSDGHDMVAPSGEGAVRCMRQ
FT                   ALAGLKGVTIDYINPHATSTPVGDDKEIEAIREVFGTGDSCPPISATKSLTGHSLGATG
FT                   VQEAIYSLLMMNNGFICESAHIDELDPAFADMPILRRRVDDARLGHVLSNSFGFGGTNA
FT                   TLILKHVDA"
     MRRVAITGMG IVSSIGNNTQ EVLASLREAR SGITHAESFA AHGFRCQVQG APTLDPESVV        60
     DRRAMRFHGG GTAWNHVAME QAIRDAGLEE REVSHERTGI IMGSGGPSTR AIVEAADIAR       120
     AKGPKRVGPF AVPKAMCSTA SATLATWFKI KGVNYSISSA CATSNHCIGN AAEIIQAGRQ       180
     DIIFAGGCEE LDWTLSVLFD AMGAMSAKYN DTPARASRAY DAGRDGFVIA GGAGVLVLEE       240
     LEHAKARGAR IYGEIAGYGA TSDGHDMVAP SGEGAVRCMR QALAGLKGVT IDYINPHATS       300
     TPVGDDKEIE AIREVFGTGD SCPPISATKS LTGHSLGATG VQEAIYSLLM MNNGFICESA       360
     HIDELDPAFA DMPILRRRVD DARLGHVLSN SFGFGGTNAT LILKHVDA                    408
//

If you have problems or comments...

PBIL Back to PBIL home page