(data stored in ACNUC7421 zone)

EMBL: CP001349.PE374

CP001349.PE374       Location/Qualifiers
FT   CDS             427344..428171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0384"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="KEGG: met:M446_2227 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55426"
FT                   /db_xref="GOA:B8IB33"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB33"
FT                   /inference="similar to AA sequence:KEGG:M446_2227"
FT                   /protein_id="ACL55426.1"
FT                   /translation="MTGLMAGKRGLIMGVANDHSIAWGVAKALAAQGAELAFTYQGEAL
FT                   GRRVTPLAASLGSRIVLPCDVEDLGSVDAVFTALGDAWPDGFDFVVHAIGYSDKTQLKG
FT                   RYVDATTRENFSRTMVISCFSFTEVAQRAAKRLRPGGALLTLTFGGATRVMPNYNVMGL
FT                   AKAALEASVRYLASDLGPDGIRVNAISAGPVRTLAGAGITDARLMFNHQRAHAPLRRNA
FT                   TIEEIGGAALYLLSDLSSGVTGEVHFVDCGFNIIAMPRPAVLKAQDDAGVVGD"
     MTGLMAGKRG LIMGVANDHS IAWGVAKALA AQGAELAFTY QGEALGRRVT PLAASLGSRI        60
     VLPCDVEDLG SVDAVFTALG DAWPDGFDFV VHAIGYSDKT QLKGRYVDAT TRENFSRTMV       120
     ISCFSFTEVA QRAAKRLRPG GALLTLTFGG ATRVMPNYNV MGLAKAALEA SVRYLASDLG       180
     PDGIRVNAIS AGPVRTLAGA GITDARLMFN HQRAHAPLRR NATIEEIGGA ALYLLSDLSS       240
     GVTGEVHFVD CGFNIIAMPR PAVLKAQDDA GVVGD                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page