(data stored in ACNUC7421 zone)

EMBL: CP001349.PE375

CP001349.PE375       Location/Qualifiers
FT   CDS             428546..430243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0385"
FT                   /product="adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="TIGRFAM: adenine deaminase; PFAM: amidohydrolase;
FT                   KEGG: met:M446_2226 adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55427"
FT                   /db_xref="GOA:B8IB34"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IB34"
FT                   /inference="protein motif:TFAM:TIGR01178"
FT                   /protein_id="ACL55427.1"
FT                   /translation="MPAEIARRIAQGAGREPADLVIRGARLLDLVTGELVPTDIAVCGE
FT                   VVVGTYGEYEGARVIEAASRIAVPGFIDTHLHIESSLITPHEFDRCVLPHGVTTAIWDP
FT                   HELANVLGTAAFDYALQASTETAMDIRVQLSSCVPATDLESAGARIEAADLLPYRDHPR
FT                   SLGIAEFMNFPGVVQADPGCLAKLAAFAGRHVDGHAPLLSGSGLNAYAAAGIRTDHEAT
FT                   GAAEALEKIRKGMTVLIREGSVSKDLAALAPLLTVATSPFLAFCTDDRNPLDIAEEGHL
FT                   DHLIRTAIRLGVPPLAAYRAASLSAATAFGLTDRGMIAPGRRADIVLLDDLEACAVARV
FT                   IAGGRAVEEALFAGRARTPAPGRGSVKAAPVAAEDFRIPGADGAETSVIGVVPGRIITE
FT                   HRRLELPAANGCAGCDLDQDVVKVAVIARHGRPGMGRGFVQGFGLRRGAIASSVGHDSH
FT                   NLCVVGADDADMAVAINRLIALQGGFVVAAGGTVLAELALPIAGLMSDLPFEAVRDALH
FT                   PLREAARTLGCTLPEPFLQVAFLPLPVIPHLKITDRGLVDVDRMRLLG"
     MPAEIARRIA QGAGREPADL VIRGARLLDL VTGELVPTDI AVCGEVVVGT YGEYEGARVI        60
     EAASRIAVPG FIDTHLHIES SLITPHEFDR CVLPHGVTTA IWDPHELANV LGTAAFDYAL       120
     QASTETAMDI RVQLSSCVPA TDLESAGARI EAADLLPYRD HPRSLGIAEF MNFPGVVQAD       180
     PGCLAKLAAF AGRHVDGHAP LLSGSGLNAY AAAGIRTDHE ATGAAEALEK IRKGMTVLIR       240
     EGSVSKDLAA LAPLLTVATS PFLAFCTDDR NPLDIAEEGH LDHLIRTAIR LGVPPLAAYR       300
     AASLSAATAF GLTDRGMIAP GRRADIVLLD DLEACAVARV IAGGRAVEEA LFAGRARTPA       360
     PGRGSVKAAP VAAEDFRIPG ADGAETSVIG VVPGRIITEH RRLELPAANG CAGCDLDQDV       420
     VKVAVIARHG RPGMGRGFVQ GFGLRRGAIA SSVGHDSHNL CVVGADDADM AVAINRLIAL       480
     QGGFVVAAGG TVLAELALPI AGLMSDLPFE AVRDALHPLR EAARTLGCTL PEPFLQVAFL       540
     PLPVIPHLKI TDRGLVDVDR MRLLG                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page