(data stored in ACNUC7421 zone)

EMBL: CP001349.PE376

CP001349.PE376       Location/Qualifiers
FT   CDS             430347..431252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0386"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IIA hydrolase
FT                   like protein; HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   met:M446_2225 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55428"
FT                   /db_xref="GOA:B8IB35"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB35"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACL55428.1"
FT                   /translation="MADTRVKPRPDEVPILDGIADLAPRFDVILCDVWGVLHDGVRAHA
FT                   AAGDALTRFRALPGERPRRVVLVSNAPRPGSAIQVQLDGFGLPRSAYDAIVTSGDLTRA
FT                   LIAARGDAPLYHLGPDRDLPIFEGLPARRVPPDEAEHVVCTGLFDDDVETAEDYRPSLA
FT                   PLKERGLPMICANPDLVVERGARLIPCAGAIASLYEAMGGEVIYAGKPHRPVYEAAVEA
FT                   AAALDGLPPAPSGRVLAIGDAIRTDIAGAHGFGIASVLVARGIHAEELGCAAGAPLAEV
FT                   AHWLEAQPVHPDAVIEVLRW"
     MADTRVKPRP DEVPILDGIA DLAPRFDVIL CDVWGVLHDG VRAHAAAGDA LTRFRALPGE        60
     RPRRVVLVSN APRPGSAIQV QLDGFGLPRS AYDAIVTSGD LTRALIAARG DAPLYHLGPD       120
     RDLPIFEGLP ARRVPPDEAE HVVCTGLFDD DVETAEDYRP SLAPLKERGL PMICANPDLV       180
     VERGARLIPC AGAIASLYEA MGGEVIYAGK PHRPVYEAAV EAAAALDGLP PAPSGRVLAI       240
     GDAIRTDIAG AHGFGIASVL VARGIHAEEL GCAAGAPLAE VAHWLEAQPV HPDAVIEVLR       300
     W                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page