(data stored in ACNUC7421 zone)

EMBL: CP001349.PE377

CP001349.PE377       Location/Qualifiers
FT   CDS             complement(431253..431843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0387"
FT                   /product="putative chemotaxis phosphatase, CheZ"
FT                   /note="KEGG: met:M446_2224 putative chemotaxis phosphatase,
FT                   CheZ"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55429"
FT                   /db_xref="GOA:B8IB36"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB36"
FT                   /inference="similar to AA sequence:KEGG:M446_2224"
FT                   /protein_id="ACL55429.1"
FT                   /translation="MLGDRMVRLVTMLMRKRTDGPSASAAPTADTIDAGTIVQDLIEIA
FT                   DYIKRLKQAIAHLRANELRCDRLPMAHDELGSVVSATASATNRIMEVAEGILSIEDDTL
FT                   EGYRAKVEAGIFQIFEACTFQDITGQRIAKVVDALGQVEERLTHFASVVKVSDGEVDPE
FT                   EARRKARREELLLNGPQLKGPETPQDAIDALFA"
     MLGDRMVRLV TMLMRKRTDG PSASAAPTAD TIDAGTIVQD LIEIADYIKR LKQAIAHLRA        60
     NELRCDRLPM AHDELGSVVS ATASATNRIM EVAEGILSIE DDTLEGYRAK VEAGIFQIFE       120
     ACTFQDITGQ RIAKVVDALG QVEERLTHFA SVVKVSDGEV DPEEARRKAR REELLLNGPQ       180
     LKGPETPQDA IDALFA                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page