(data stored in ACNUC7421 zone)

EMBL: CP001349.PE378

CP001349.PE378       Location/Qualifiers
FT   CDS             complement(431985..432368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0388"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   met:M446_2223 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55430"
FT                   /db_xref="GOA:B8IB37"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB37"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55430.1"
FT                   /translation="MALDLSMPILVVDDYQTMVRIIRNLLKQLGFEEVDDASDGTGALA
FT                   KLKQKKYGLVISDWNMEPMTGYELLRHVRADDALRTTPFIMVTAESKTENVIAAKKAGV
FT                   NNYIVKPFNAQTLKTKIEAVCGA"
     MALDLSMPIL VVDDYQTMVR IIRNLLKQLG FEEVDDASDG TGALAKLKQK KYGLVISDWN        60
     MEPMTGYELL RHVRADDALR TTPFIMVTAE SKTENVIAAK KAGVNNYIVK PFNAQTLKTK       120
     IEAVCGA                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page