(data stored in ACNUC7421 zone)

EMBL: CP001349.PE379

CP001349.PE379       Location/Qualifiers
FT   CDS             432812..433828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0389"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   FAD synthetase; Riboflavin kinase; KEGG: met:M446_2222
FT                   riboflavin biosynthesis protein RibF"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55431"
FT                   /db_xref="GOA:B8IB38"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB38"
FT                   /inference="protein motif:TFAM:TIGR00083"
FT                   /protein_id="ACL55431.1"
FT                   /translation="MPPSDETAATGSAASAPPRSVLIVNRDGEPVPEGLRGAVAAIGNF
FT                   DGLHRGHRALIAAVREIAAAAGRPSAVLTFEPHPREFFAPDVGMFRLTDEGAKLAVLAR
FT                   LGIDGVFVRRFDAALAGTSAAAFVGRLLKDELGLTGVVIGHDFHFGRGREGTPAVLQAL
FT                   CAEHGLTCRVIEPVAAECGEVPVSSSAIRAALEAGDVAGANRLLGFRWFVQGVVRHGDK
FT                   RGRTLGFPTANVALPACGLAHGIYAVRVRLADGALREGVASYGRRPTFDNGAPLLETTL
FT                   FDFSGDLYGQRIAVEFVGFLRGEARFDSAEALVAQMHEDAAQARALLARDEVPSMLG"
     MPPSDETAAT GSAASAPPRS VLIVNRDGEP VPEGLRGAVA AIGNFDGLHR GHRALIAAVR        60
     EIAAAAGRPS AVLTFEPHPR EFFAPDVGMF RLTDEGAKLA VLARLGIDGV FVRRFDAALA       120
     GTSAAAFVGR LLKDELGLTG VVIGHDFHFG RGREGTPAVL QALCAEHGLT CRVIEPVAAE       180
     CGEVPVSSSA IRAALEAGDV AGANRLLGFR WFVQGVVRHG DKRGRTLGFP TANVALPACG       240
     LAHGIYAVRV RLADGALREG VASYGRRPTF DNGAPLLETT LFDFSGDLYG QRIAVEFVGF       300
     LRGEARFDSA EALVAQMHED AAQARALLAR DEVPSMLG                               338
//

If you have problems or comments...

PBIL Back to PBIL home page