(data stored in ACNUC7421 zone)

EMBL: CP001349.PE38

CP001349.PE38        Location/Qualifiers
FT   CDS             41301..42596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0039"
FT                   /product="crotonyl-CoA reductase"
FT                   /note="TIGRFAM: crotonyl-CoA reductase; PFAM: Alcohol
FT                   dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: met:M446_0037
FT                   crotonyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55090"
FT                   /db_xref="GOA:B8IT28"
FT                   /db_xref="InterPro:IPR010085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT28"
FT                   /inference="protein motif:TFAM:TIGR01751"
FT                   /protein_id="ACL55090.1"
FT                   /translation="MGAGAAVQPIAGGAGQLKDLYEIGEIPPLGHVPAKMYAWAIRRER
FT                   HGPPEQSMQIEVVPTWSIGDDEVLVLVMAAGVNYNGVWAGLGEPISPFDVHKAPFHVAG
FT                   SDASGIVWAVGAKVKRWKVGDEVIVHCNQDDGDDEECNGGDPMFSPSQRIWGYETPDGS
FT                   FGQFCRVQSRQLMKRPKHLTWEESACYTLTLATAYRMLFGHAPHTVRPGQNVLVWGASG
FT                   GLGVFGVQLCAASGANAIAVISDESKRDYVMSLGAKGVINRKEFNCWGQLPKVNSPEYN
FT                   EWLKEARKFGKAIWDITGKGNDVDIVFEHPGEATFPVSTLVVKRGGMVVFCAGTTGFNI
FT                   TFDARYVWMRQKRIQGSHFAHLKQAAAANQFVLDQRVDPCMSELFPWDKIPVAHTKMWK
FT                   NQHAPGNMAVLVNSPKAGLRTFDDVLELSGSR"
     MGAGAAVQPI AGGAGQLKDL YEIGEIPPLG HVPAKMYAWA IRRERHGPPE QSMQIEVVPT        60
     WSIGDDEVLV LVMAAGVNYN GVWAGLGEPI SPFDVHKAPF HVAGSDASGI VWAVGAKVKR       120
     WKVGDEVIVH CNQDDGDDEE CNGGDPMFSP SQRIWGYETP DGSFGQFCRV QSRQLMKRPK       180
     HLTWEESACY TLTLATAYRM LFGHAPHTVR PGQNVLVWGA SGGLGVFGVQ LCAASGANAI       240
     AVISDESKRD YVMSLGAKGV INRKEFNCWG QLPKVNSPEY NEWLKEARKF GKAIWDITGK       300
     GNDVDIVFEH PGEATFPVST LVVKRGGMVV FCAGTTGFNI TFDARYVWMR QKRIQGSHFA       360
     HLKQAAAANQ FVLDQRVDPC MSELFPWDKI PVAHTKMWKN QHAPGNMAVL VNSPKAGLRT       420
     FDDVLELSGS R                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page