(data stored in ACNUC7421 zone)

EMBL: CP001349.PE380

CP001349.PE380       Location/Qualifiers
FT   CDS             complement(433981..434256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55432"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB39"
FT                   /inference="similar to AA sequence:KEGG:M446_2221"
FT                   /protein_id="ACL55432.1"
FT                   /translation="MRTLVPILVLAVSLSAPALAAEARGSAVQPRAAAPYSGSPQVGTP
FT                   YDDIDATGSVGPTDPILIPDYDGPEIDVDRPRRDETERALREFIPE"
     MRTLVPILVL AVSLSAPALA AEARGSAVQP RAAAPYSGSP QVGTPYDDID ATGSVGPTDP        60
     ILIPDYDGPE IDVDRPRRDE TERALREFIP E                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page