(data stored in ACNUC7421 zone)

EMBL: CP001349.PE381

CP001349.PE381       Location/Qualifiers
FT   CDS             434589..437558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0391"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   met:M446_2220 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55433"
FT                   /db_xref="GOA:B8IB40"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB40"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ACL55433.1"
FT                   /translation="MTETKPASGRDYSETLFLPRTDFPMRAGLPEREPEILKRWQAIDL
FT                   YGRIRAAAAGRPKFVLHDGPPYANGHIHIGTALNKILKDVVVRAAGLLGTDANYVPGWD
FT                   CHGLPIEWKIEEQYRAKGRNKDEVPVIEFRRECRAFAEHWLSVQREEFKRLGVTGDWDH
FT                   PYSTMAYPAEAQIARELMTFAMTGQLYRGSKPVMWSVVEKTALAEAEVEYEDIVSDAIW
FT                   AAFPVVTSADPALAGAHVVIWTTTPWTIPANRAVAYSRKISYGLYRVSAAPEENWVQPD
FT                   FRCIVADELAGDVFKAARVDAVERLADVAPEALAGLTLAHPLGGWNEGYRFPVPMLEGE
FT                   HVTDEAGTGFVHTAPSHGREDFEVWMANSRALRERGIDVRIPYTVDADGVLTVEAPGFT
FT                   GRRVLTEKGEKGDANKAVIAALAEAGTLVARGTLKHSYPHSWRSKKRVIFRNTPQWFIA
FT                   LDAPVASLGSKTLREVALREIAATEWVPPQGQNRITGMIANRPDWVVSRQRAWGVPITV
FT                   FVKKGTSEILRDERVNARIVAAFAEEGADAWFADPDGARFLAPDHDPAAYEKVTDVLDV
FT                   WFDSGSTHAFTLEDPVAFPGLAGIRRRRDGGDDTVMYLEGSDQHRGWFHSSLLESCGTR
FT                   GRAPYDVVLTHGFVLDPKGEKMSKSRGNVVAPQDVIAASGADILRLWVAASDYTDDLRI
FT                   GPPIIKTFSETYRKLRNSLRWMLGTLAHHRPEDRVAPQAMPELERFILHRLAELDGEIR
FT                   EAYRTYDFKRVVALLNGFMTGDLSSFYFDVRKDALYCDPLSSTVRRAALTVVDETFRRV
FT                   VVWLAPVLAFTAEEAWLSRYPSEDGSVHLQTLPDTPSDWRDEALAARWARIRRVRRVVT
FT                   GALEIERAKKRIGASLEAAPIVYLADPDLQAALDGIDFAEICITSDIRIEAGEGPQDAF
FT                   RLDDVGGVAVVPALAEGRKCARSWKVLPSVGSDPDYPDVTPRDAQALREWDALHAKAAE
FT                   "
     MTETKPASGR DYSETLFLPR TDFPMRAGLP EREPEILKRW QAIDLYGRIR AAAAGRPKFV        60
     LHDGPPYANG HIHIGTALNK ILKDVVVRAA GLLGTDANYV PGWDCHGLPI EWKIEEQYRA       120
     KGRNKDEVPV IEFRRECRAF AEHWLSVQRE EFKRLGVTGD WDHPYSTMAY PAEAQIAREL       180
     MTFAMTGQLY RGSKPVMWSV VEKTALAEAE VEYEDIVSDA IWAAFPVVTS ADPALAGAHV       240
     VIWTTTPWTI PANRAVAYSR KISYGLYRVS AAPEENWVQP DFRCIVADEL AGDVFKAARV       300
     DAVERLADVA PEALAGLTLA HPLGGWNEGY RFPVPMLEGE HVTDEAGTGF VHTAPSHGRE       360
     DFEVWMANSR ALRERGIDVR IPYTVDADGV LTVEAPGFTG RRVLTEKGEK GDANKAVIAA       420
     LAEAGTLVAR GTLKHSYPHS WRSKKRVIFR NTPQWFIALD APVASLGSKT LREVALREIA       480
     ATEWVPPQGQ NRITGMIANR PDWVVSRQRA WGVPITVFVK KGTSEILRDE RVNARIVAAF       540
     AEEGADAWFA DPDGARFLAP DHDPAAYEKV TDVLDVWFDS GSTHAFTLED PVAFPGLAGI       600
     RRRRDGGDDT VMYLEGSDQH RGWFHSSLLE SCGTRGRAPY DVVLTHGFVL DPKGEKMSKS       660
     RGNVVAPQDV IAASGADILR LWVAASDYTD DLRIGPPIIK TFSETYRKLR NSLRWMLGTL       720
     AHHRPEDRVA PQAMPELERF ILHRLAELDG EIREAYRTYD FKRVVALLNG FMTGDLSSFY       780
     FDVRKDALYC DPLSSTVRRA ALTVVDETFR RVVVWLAPVL AFTAEEAWLS RYPSEDGSVH       840
     LQTLPDTPSD WRDEALAARW ARIRRVRRVV TGALEIERAK KRIGASLEAA PIVYLADPDL       900
     QAALDGIDFA EICITSDIRI EAGEGPQDAF RLDDVGGVAV VPALAEGRKC ARSWKVLPSV       960
     GSDPDYPDVT PRDAQALREW DALHAKAAE                                         989
//

If you have problems or comments...

PBIL Back to PBIL home page