(data stored in ACNUC7421 zone)

EMBL: CP001349.PE382

CP001349.PE382       Location/Qualifiers
FT   CDS             437630..438127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0392"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: met:M446_2219
FT                   lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55434"
FT                   /db_xref="GOA:B8IB41"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IB41"
FT                   /inference="protein motif:TFAM:TIGR00077"
FT                   /protein_id="ACL55434.1"
FT                   /translation="MRPLPFGLLVAAATLVLDQATKLGLLFLTDLPIRQPIVLAPFAQL
FT                   VVVWNRGVSYGLFQQHTELGRWLLVAVSVLAAVALTAWMARTGTRLLAGALGLIVGGAI
FT                   GNAIDRIAYGAVFDFVHLHAGGWSWYVFNVADAGIVLGVAGLLYDAVRAERRNAREIRS
FT                   DA"
     MRPLPFGLLV AAATLVLDQA TKLGLLFLTD LPIRQPIVLA PFAQLVVVWN RGVSYGLFQQ        60
     HTELGRWLLV AVSVLAAVAL TAWMARTGTR LLAGALGLIV GGAIGNAIDR IAYGAVFDFV       120
     HLHAGGWSWY VFNVADAGIV LGVAGLLYDA VRAERRNARE IRSDA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page