(data stored in ACNUC7421 zone)

EMBL: CP001349.PE383

CP001349.PE383       Location/Qualifiers
FT   CDS             438269..438931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55435"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB42"
FT                   /inference="similar to AA sequence:KEGG:M446_2218"
FT                   /protein_id="ACL55435.1"
FT                   /translation="MRNQRTILALTAILCGAAPGAQAEDGVFMKKALSSIGLIEPERPT
FT                   ITYRERAPLVLPPKMDKAALPPPVPRSAVREVAPQWPTDPEAVARARRAEDDRKPRGMR
FT                   GEQGRMSDNNTTLSIHEMRGGRREGAGIPKEPVYKPGDNVREATWLSPLELFKGRKDED
FT                   ATPSDVEPSRDMLTDPPTGYRAPPGGRLVRSDSGPKGMPISDREEADPRAYLRSRQQ"
     MRNQRTILAL TAILCGAAPG AQAEDGVFMK KALSSIGLIE PERPTITYRE RAPLVLPPKM        60
     DKAALPPPVP RSAVREVAPQ WPTDPEAVAR ARRAEDDRKP RGMRGEQGRM SDNNTTLSIH       120
     EMRGGRREGA GIPKEPVYKP GDNVREATWL SPLELFKGRK DEDATPSDVE PSRDMLTDPP       180
     TGYRAPPGGR LVRSDSGPKG MPISDREEAD PRAYLRSRQQ                             220
//

If you have problems or comments...

PBIL Back to PBIL home page