(data stored in ACNUC7421 zone)

EMBL: CP001349.PE384

CP001349.PE384       Location/Qualifiers
FT   CDS             439218..440597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0394"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   met:M446_2217 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55436"
FT                   /db_xref="GOA:B8IB43"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB43"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL55436.1"
FT                   /translation="MHSRTRPLLRPTDRPGPALRLDAAPYGRAEAGGPEVASFTLDNGL
FT                   DVVVIPDHRAPVATHMIWYRNGSADDPLGQSGIAHFLEHLMFKGTAKHPAGAFSKAVSS
FT                   LGGQENAFTSFDYTAYFQRVARDNLKTMMEFEADRMTGLVLDDAVVAPERDVVLEERRM
FT                   RVETDPSAQLSEAMAASLFVHHPYGIPIIGWMHEIEELNRTHALAYYQRFYTPENAILV
FT                   VAGDVTGDEVRRLAEATYGQVAPRGERPVRLRPREPEPRAARRLSVADPKVEQPTLQRL
FT                   YLTPSCITAKDGEGHALELLAEVMGGGPTSYLYRSLVMEQGVAVNAGAWYMGSAMDDTR
FT                   FSVYAVPAEGVSLERLEEALDRALRRLPAEALAPEAVERAKTRLVAETVYSSDSQSSLA
FT                   RIYGSALAIGESIEEVRRWPADIEAVEADRLATAAERYLTPARSVTGYLTKAREADAAV
FT                   A"
     MHSRTRPLLR PTDRPGPALR LDAAPYGRAE AGGPEVASFT LDNGLDVVVI PDHRAPVATH        60
     MIWYRNGSAD DPLGQSGIAH FLEHLMFKGT AKHPAGAFSK AVSSLGGQEN AFTSFDYTAY       120
     FQRVARDNLK TMMEFEADRM TGLVLDDAVV APERDVVLEE RRMRVETDPS AQLSEAMAAS       180
     LFVHHPYGIP IIGWMHEIEE LNRTHALAYY QRFYTPENAI LVVAGDVTGD EVRRLAEATY       240
     GQVAPRGERP VRLRPREPEP RAARRLSVAD PKVEQPTLQR LYLTPSCITA KDGEGHALEL       300
     LAEVMGGGPT SYLYRSLVME QGVAVNAGAW YMGSAMDDTR FSVYAVPAEG VSLERLEEAL       360
     DRALRRLPAE ALAPEAVERA KTRLVAETVY SSDSQSSLAR IYGSALAIGE SIEEVRRWPA       420
     DIEAVEADRL ATAAERYLTP ARSVTGYLTK AREADAAVA                              459
//

If you have problems or comments...

PBIL Back to PBIL home page