(data stored in ACNUC7421 zone)

EMBL: CP001349.PE385

CP001349.PE385       Location/Qualifiers
FT   CDS             440641..441954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0395"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   met:M446_2216 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55437"
FT                   /db_xref="GOA:B8IB44"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB44"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL55437.1"
FT                   /translation="MTLADAATRTAALATPSSPAKARSVIAASGVEAWHVESPVVPLVA
FT                   LAFTFEGGAAQDPEGKSGAVQMLSRLLDEGAGPYGSDAFQERLAARAIELNFHAGPDAV
FT                   GGSLKMLVKHADEAIELLALALAEPRFDEAAVERVRAQMLAGIRYQQNDPGVMASRRFF
FT                   SEAYPGHPYGRPSGGTLESVASITRDDLVALHRRLISRARVKVAAVGAIGEAALQRALD
FT                   AAFGPLSEGGPLAEVPPTRIAGLGTAGSGRRIVVDLDVPQSVIRFGADGVPWRDPDFIP
FT                   AYVLNHILGGGAFTSRLFQEVREKRGLAYSVGTSLVSHRAASMVWGYTATKNERVAEAL
FT                   SVIGEEIARLTRDGPSDEELQKAKDYLTGSYALGFDTSTKIAHQLVQVAFEGLGIDYIS
FT                   RRNGLIAAVTQDDIRRAAARTLGDGRLLVVAAGRPTEI"
     MTLADAATRT AALATPSSPA KARSVIAASG VEAWHVESPV VPLVALAFTF EGGAAQDPEG        60
     KSGAVQMLSR LLDEGAGPYG SDAFQERLAA RAIELNFHAG PDAVGGSLKM LVKHADEAIE       120
     LLALALAEPR FDEAAVERVR AQMLAGIRYQ QNDPGVMASR RFFSEAYPGH PYGRPSGGTL       180
     ESVASITRDD LVALHRRLIS RARVKVAAVG AIGEAALQRA LDAAFGPLSE GGPLAEVPPT       240
     RIAGLGTAGS GRRIVVDLDV PQSVIRFGAD GVPWRDPDFI PAYVLNHILG GGAFTSRLFQ       300
     EVREKRGLAY SVGTSLVSHR AASMVWGYTA TKNERVAEAL SVIGEEIARL TRDGPSDEEL       360
     QKAKDYLTGS YALGFDTSTK IAHQLVQVAF EGLGIDYISR RNGLIAAVTQ DDIRRAAART       420
     LGDGRLLVVA AGRPTEI                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page