(data stored in ACNUC7421 zone)

EMBL: CP001349.PE386

CP001349.PE386       Location/Qualifiers
FT   CDS             complement(442080..442517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0396"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   met:M446_2215 cupin 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55438"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017102"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB45"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACL55438.1"
FT                   /translation="MSDVVDSPTCRVVRAGDAFVGKQALTYAPGISAESVGSRGIHLQT
FT                   VTMPPGARARAHLHEGHETALHVLSGVAGMWYGPRLEHHMWNRAGDYVYIPAGVPHLPY
FT                   NASRTETCIAVIARTDPNEQESVVLLPELDEVRPAGEDPMA"
     MSDVVDSPTC RVVRAGDAFV GKQALTYAPG ISAESVGSRG IHLQTVTMPP GARARAHLHE        60
     GHETALHVLS GVAGMWYGPR LEHHMWNRAG DYVYIPAGVP HLPYNASRTE TCIAVIARTD       120
     PNEQESVVLL PELDEVRPAG EDPMA                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page