(data stored in ACNUC7421 zone)

EMBL: CP001349.PE387

CP001349.PE387       Location/Qualifiers
FT   CDS             442613..443455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0397"
FT                   /product="Urease accessory protein UreD"
FT                   /note="PFAM: Urease accessory protein UreD; KEGG:
FT                   met:M446_2214 urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55439"
FT                   /db_xref="GOA:B8IB46"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB46"
FT                   /inference="protein motif:PFAM:PF01774"
FT                   /protein_id="ACL55439.1"
FT                   /translation="MSSPAPWPQRQRSDGRVMLVAGRMPGGATRLTDLAESGPLRLRLP
FT                   QMAGGALEGVFLNSAGGIACGDRFAIAADLAPGADLVLTTTAAEKIYRSDGPVTEIAAD
FT                   LRVAEGARLAWLPQETILYDGARLRRRLTAELAPGATLTLFEALVFGRAARGETVSEGL
FT                   LHDVWRLSRAGRLVYADTLRLDGPIADQMARPAIAGGARALATLIHVAADAEARLEEMR
FT                   ALIETAGCEGLGIEAGASAWNGLLAVRLLARGIGPLRQAATRILEGFRGVPLPRVWQT"
     MSSPAPWPQR QRSDGRVMLV AGRMPGGATR LTDLAESGPL RLRLPQMAGG ALEGVFLNSA        60
     GGIACGDRFA IAADLAPGAD LVLTTTAAEK IYRSDGPVTE IAADLRVAEG ARLAWLPQET       120
     ILYDGARLRR RLTAELAPGA TLTLFEALVF GRAARGETVS EGLLHDVWRL SRAGRLVYAD       180
     TLRLDGPIAD QMARPAIAGG ARALATLIHV AADAEARLEE MRALIETAGC EGLGIEAGAS       240
     AWNGLLAVRL LARGIGPLRQ AATRILEGFR GVPLPRVWQT                             280
//

If you have problems or comments...

PBIL Back to PBIL home page