(data stored in ACNUC7421 zone)

EMBL: CP001349.PE388

CP001349.PE388       Location/Qualifiers
FT   CDS             443534..444154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0398"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="TIGRFAM: urease, beta subunit; urease, gamma
FT                   subunit; PFAM: Urease beta subunit; Urease gamma subunit
FT                   region; KEGG: met:M446_2213 urease, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55440"
FT                   /db_xref="GOA:B8IB47"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR008223"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB47"
FT                   /inference="protein motif:TFAM:TIGR00193"
FT                   /protein_id="ACL55440.1"
FT                   /translation="MLLTPREKDKLLVAMAAQVARNRLARGVKLNFPEAVALITDFVVE
FT                   GARDGRTVAELMQAGAQVLDASQVMEGVPEMIHDIQVEATFPDGTKLVTVHHPIRGAPS
FT                   AEVPGAVTTPPGEIVFNAGAPRTVIEVANTGDRPIQVGSHYHFFEVNPALHFDREKARG
FT                   QRLDIAPGTAVRFEPGATREVTLVPMGGAREVYGFRGDVMGQL"
     MLLTPREKDK LLVAMAAQVA RNRLARGVKL NFPEAVALIT DFVVEGARDG RTVAELMQAG        60
     AQVLDASQVM EGVPEMIHDI QVEATFPDGT KLVTVHHPIR GAPSAEVPGA VTTPPGEIVF       120
     NAGAPRTVIE VANTGDRPIQ VGSHYHFFEV NPALHFDREK ARGQRLDIAP GTAVRFEPGA       180
     TREVTLVPMG GAREVYGFRG DVMGQL                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page