(data stored in ACNUC7421 zone)

EMBL: CP001349.PE389

CP001349.PE389       Location/Qualifiers
FT   CDS             444188..445915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0399"
FT                   /product="urease, alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="TIGRFAM: urease, alpha subunit; PFAM:
FT                   amidohydrolase; Urease alpha-subunit domain protein;
FT                   Amidohydrolase 3; KEGG: met:M446_2211 urease, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55441"
FT                   /db_xref="GOA:B8IB48"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB48"
FT                   /inference="protein motif:TFAM:TIGR01792"
FT                   /protein_id="ACL55441.1"
FT                   /translation="MSNTPKPASLPRAAYAGMFGPTKGDRIRLADTCLVIEVEHDHTRY
FT                   GEEVKFGGGKVIRDGMGQGQASNAAGAVDTVITNAVVLDHWGIVKCDVGLTGGRIAALG
FT                   KAGNPDIQDGVTIVVGPGTEVIAGEGKILTAGGFDSHIHYICPQQIEEALNSGVTTMLG
FT                   GGTGPAHGTFATTCTPGPWHIARMIEAADAFPMNLAFAGKGNASRPESLEEMIRAGACA
FT                   LKLHEDWGTTPAAIDCCLTVADSHDVQVMIHTDTLNESGFVEDTIAAFKGRTIHAFHTE
FT                   GAGGGHAPDIIKVAGLPNVLPSSTNPTRPYTRNTIDEHLDMLMVCHHLSPAIPEDLAFA
FT                   ESRIRKETIAAEDILHDLGALSIMSSDSQAMGRVGEVVIRTWQTADKMKRQRGALPGDS
FT                   AGNDNLRARRYVAKYTINPAIAHGVAKHIGSVEPGKLADLVLWSPAFFGVKPDLVIKGG
FT                   AIATAPMGDPNASIPTPQPVHYRPMFGAFGRVPATTSLTFVSKAAVEAGLRDRLRVQKD
FT                   LVAVENVRGGIGKRSMILNDATPVIEVDPETYDVRADGQLLVCEPAEVVPMAQRYFLF"
     MSNTPKPASL PRAAYAGMFG PTKGDRIRLA DTCLVIEVEH DHTRYGEEVK FGGGKVIRDG        60
     MGQGQASNAA GAVDTVITNA VVLDHWGIVK CDVGLTGGRI AALGKAGNPD IQDGVTIVVG       120
     PGTEVIAGEG KILTAGGFDS HIHYICPQQI EEALNSGVTT MLGGGTGPAH GTFATTCTPG       180
     PWHIARMIEA ADAFPMNLAF AGKGNASRPE SLEEMIRAGA CALKLHEDWG TTPAAIDCCL       240
     TVADSHDVQV MIHTDTLNES GFVEDTIAAF KGRTIHAFHT EGAGGGHAPD IIKVAGLPNV       300
     LPSSTNPTRP YTRNTIDEHL DMLMVCHHLS PAIPEDLAFA ESRIRKETIA AEDILHDLGA       360
     LSIMSSDSQA MGRVGEVVIR TWQTADKMKR QRGALPGDSA GNDNLRARRY VAKYTINPAI       420
     AHGVAKHIGS VEPGKLADLV LWSPAFFGVK PDLVIKGGAI ATAPMGDPNA SIPTPQPVHY       480
     RPMFGAFGRV PATTSLTFVS KAAVEAGLRD RLRVQKDLVA VENVRGGIGK RSMILNDATP       540
     VIEVDPETYD VRADGQLLVC EPAEVVPMAQ RYFLF                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page