(data stored in ACNUC7421 zone)

EMBL: CP001349.PE39

CP001349.PE39        Location/Qualifiers
FT   CDS             complement(42670..43782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0040"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="SMART: regulatory protein LuxR; KEGG: met:M446_0039
FT                   LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55091"
FT                   /db_xref="GOA:B8IT29"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT29"
FT                   /inference="protein motif:SMART:SM00421"
FT                   /protein_id="ACL55091.1"
FT                   /translation="MAEVREDRLAATIDLFYEAAMQPERWPSALEAYGEALGADGALML
FT                   TGPEAPLSPTISEGVAEIVAIGLRDGWLADNPRIARGIPALINDPQGVVTESHLFTPQE
FT                   LDEIPFNAEYVARYGFRWFAGAYLVPDGNRSVILSAERRREREMYSHREIEQIERAVPH
FT                   LQRAGQIAVRLAEARAHATLDAFEMMHCGAFLLDSSGAVLRMNPQAERHLGGGLAVVKG
FT                   ALLAQHRAANADLGRLIASAIHPGKPHEAPPLGALAVPRPEGPPLVLHAAPLARTTNDI
FT                   FQRARAIIVVTDSAAGQKPGEALLRQAYGLTAAEARLANDLADGADLARVAAGLGITVA
FT                   TARTQLKAVFAKTGTHRQPELVALLTRMRP"
     MAEVREDRLA ATIDLFYEAA MQPERWPSAL EAYGEALGAD GALMLTGPEA PLSPTISEGV        60
     AEIVAIGLRD GWLADNPRIA RGIPALINDP QGVVTESHLF TPQELDEIPF NAEYVARYGF       120
     RWFAGAYLVP DGNRSVILSA ERRREREMYS HREIEQIERA VPHLQRAGQI AVRLAEARAH       180
     ATLDAFEMMH CGAFLLDSSG AVLRMNPQAE RHLGGGLAVV KGALLAQHRA ANADLGRLIA       240
     SAIHPGKPHE APPLGALAVP RPEGPPLVLH AAPLARTTND IFQRARAIIV VTDSAAGQKP       300
     GEALLRQAYG LTAAEARLAN DLADGADLAR VAAGLGITVA TARTQLKAVF AKTGTHRQPE       360
     LVALLTRMRP                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page