(data stored in ACNUC7421 zone)

EMBL: CP001349.PE390

CP001349.PE390       Location/Qualifiers
FT   CDS             446092..447669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0400"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: met:M446_2210 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55442"
FT                   /db_xref="GOA:B8IB49"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB49"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL55442.1"
FT                   /translation="MRSGLTRRMAVAFGAALVLAAGQAAAQDKRVLKAVMHSGLRITDP
FT                   IITTAYIARNHGYMIYDTLFATDERFEIRPQMVKDYSVSDDKLTYTFTLRDGLKFHDGT
FT                   PVTAEDCIASIERWGKRDGMGQKLMEYTTAMKAVGDKTFTLTLKQPYGLVLASLGKPSS
FT                   NVPFIMPKRIAETPADKNVPEEIGSGPFRFVKAEFQPGLKVVYEKNPDYVPRAEPPSWL
FT                   AGGKVVKLDRVEWINIPDYQTAVNALINGEIDYIEQPPHDFLPILKDAKGIVINNYNPL
FT                   GFSGMLRMNWLNPPFDNPKIRQAVLAAVNQQDYLDAQIGNPDYMQPCLAMFVCGTPNAT
FT                   DAGAPKLDPARAKQLLKEGGYDGRPIVIMQPTDLAIVAPLGPVTAQALRNIGMKVDLQS
FT                   MDWQTLVGRRAKQDPVDQGGWNIFHTTWVNADMLNPIANVGVNGKGKQGGWFGWAEDKE
FT                   IEAMRDAYARETDPAKQKLIAADVQKRAYEIGMYFPTGQYTSPLAVRSSLKGILQGPAP
FT                   VFWNIEKQ"
     MRSGLTRRMA VAFGAALVLA AGQAAAQDKR VLKAVMHSGL RITDPIITTA YIARNHGYMI        60
     YDTLFATDER FEIRPQMVKD YSVSDDKLTY TFTLRDGLKF HDGTPVTAED CIASIERWGK       120
     RDGMGQKLME YTTAMKAVGD KTFTLTLKQP YGLVLASLGK PSSNVPFIMP KRIAETPADK       180
     NVPEEIGSGP FRFVKAEFQP GLKVVYEKNP DYVPRAEPPS WLAGGKVVKL DRVEWINIPD       240
     YQTAVNALIN GEIDYIEQPP HDFLPILKDA KGIVINNYNP LGFSGMLRMN WLNPPFDNPK       300
     IRQAVLAAVN QQDYLDAQIG NPDYMQPCLA MFVCGTPNAT DAGAPKLDPA RAKQLLKEGG       360
     YDGRPIVIMQ PTDLAIVAPL GPVTAQALRN IGMKVDLQSM DWQTLVGRRA KQDPVDQGGW       420
     NIFHTTWVNA DMLNPIANVG VNGKGKQGGW FGWAEDKEIE AMRDAYARET DPAKQKLIAA       480
     DVQKRAYEIG MYFPTGQYTS PLAVRSSLKG ILQGPAPVFW NIEKQ                       525
//

If you have problems or comments...

PBIL Back to PBIL home page