(data stored in ACNUC7421 zone)

EMBL: CP001349.PE391

CP001349.PE391       Location/Qualifiers
FT   CDS             447677..448618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0401"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_2209
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55443"
FT                   /db_xref="GOA:B8IB50"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB50"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55443.1"
FT                   /translation="MLRFVAGRLVATLPVMGVVAVVVFGLLRLAPGDPAAILAGDAATP
FT                   EQIAAIRARLGLDEPMLQQFVSWLWRLLHGDLGTSIISNQPVTRLIGERIEPTLALATT
FT                   TILFAVLVAVPLGVVAAWRHGTWIDRAVMAFSVLGFSVPVFVLGYLWIFGAALKLGLLP
FT                   VQGYVSIREGFGPFIERLILPTLTLSVIYIALIARTTRASVLEVLGEDYIRTARAKGLR
FT                   ERRVLTRHALRNAAVPVISVIGLGIALLISGVVVTESVFNLPGLGRLTVDAVLARDYPV
FT                   IQGVILLFSGFYVLINLAIDLTYLFFDPRIRY"
     MLRFVAGRLV ATLPVMGVVA VVVFGLLRLA PGDPAAILAG DAATPEQIAA IRARLGLDEP        60
     MLQQFVSWLW RLLHGDLGTS IISNQPVTRL IGERIEPTLA LATTTILFAV LVAVPLGVVA       120
     AWRHGTWIDR AVMAFSVLGF SVPVFVLGYL WIFGAALKLG LLPVQGYVSI REGFGPFIER       180
     LILPTLTLSV IYIALIARTT RASVLEVLGE DYIRTARAKG LRERRVLTRH ALRNAAVPVI       240
     SVIGLGIALL ISGVVVTESV FNLPGLGRLT VDAVLARDYP VIQGVILLFS GFYVLINLAI       300
     DLTYLFFDPR IRY                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page