(data stored in ACNUC7421 zone)

EMBL: CP001349.PE392

CP001349.PE392       Location/Qualifiers
FT   CDS             448615..449487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0402"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_2208
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55444"
FT                   /db_xref="GOA:B8IB51"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB51"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55444.1"
FT                   /translation="MSASIAAAPRPRRLPPALRHPGVLFGLAVLLLVLVAALAAPWLGT
FT                   VDPIQLRPRLRLRPPSAAAWLGTDAFGRDVYSRVVYGARVSLAIGGAVAAIAVAAGLAI
FT                   GLVAGYIRWLDAVVMRVMDGVMAIPSILLAIALVTLSGAGIGTVIVAITIPEIPRVARL
FT                   VRGVVLTVREEPYVEAAIGAGTRLPLLLLRHVLPNTVAPLIVQGTYVCASAILTEAILS
FT                   FLGAGIPTEVPSWGNIMAEGRQAFQLAPWVILFPGLCVAATVLAVNILGDGLRDALDPR
FT                   LARRLGGVR"
     MSASIAAAPR PRRLPPALRH PGVLFGLAVL LLVLVAALAA PWLGTVDPIQ LRPRLRLRPP        60
     SAAAWLGTDA FGRDVYSRVV YGARVSLAIG GAVAAIAVAA GLAIGLVAGY IRWLDAVVMR       120
     VMDGVMAIPS ILLAIALVTL SGAGIGTVIV AITIPEIPRV ARLVRGVVLT VREEPYVEAA       180
     IGAGTRLPLL LLRHVLPNTV APLIVQGTYV CASAILTEAI LSFLGAGIPT EVPSWGNIMA       240
     EGRQAFQLAP WVILFPGLCV AATVLAVNIL GDGLRDALDP RLARRLGGVR                  290
//

If you have problems or comments...

PBIL Back to PBIL home page