(data stored in ACNUC7421 zone)

EMBL: CP001349.PE393

CP001349.PE393       Location/Qualifiers
FT   CDS             449484..451136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0403"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: met:M446_2207 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55445"
FT                   /db_xref="GOA:B8IB52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB52"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55445.1"
FT                   /translation="MTAPVLEIRDLAIPLPLRADRAYAVEGVSLAVAPGEILCVVGESG
FT                   SGKSVTAHAVMGLLPPVLKPSRGEILLQGEDVLKATPARLRGLRGGRMAMVFQEPMTAL
FT                   NPVLTVGAQIDEILEAHADRLGAAERRARVIALMRDVHLPDPERMAGAYPHQLSGGQRQ
FT                   RVMIAMALANDPALIIADEPTTALDVTTQAQILRLLRELQARREAGILFITHDFGVVAE
FT                   IADRVAVMQGGRLVEAGPAREVLHHPQDPYTRMLIAAVPSATPPPPRQRPAAQAPVLTV
FT                   RDLEKTYGGSLFSRAGRHVRALDGVSLALKPGETLGIVGESGSGKSTLARCIARFVDPS
FT                   SGEIRLDGTDIARLSDRALHPYRRRVQVIFQDPYRSLNPRRTVGQSITEGPRNYGMARD
FT                   EALARARRLIGLVGLDADALDRFPHEFSGGQRQRIAIARALAMEPDLLIADEAVSALDV
FT                   SVQAQVLDLLEEVRERLNLAILFITHDLRVAARLCDHLIVMLNGRVVEEGETAALFSDP
FT                   RHDYTKALFAAAPGASALRPEAGPRAANAAPPQ"
     MTAPVLEIRD LAIPLPLRAD RAYAVEGVSL AVAPGEILCV VGESGSGKSV TAHAVMGLLP        60
     PVLKPSRGEI LLQGEDVLKA TPARLRGLRG GRMAMVFQEP MTALNPVLTV GAQIDEILEA       120
     HADRLGAAER RARVIALMRD VHLPDPERMA GAYPHQLSGG QRQRVMIAMA LANDPALIIA       180
     DEPTTALDVT TQAQILRLLR ELQARREAGI LFITHDFGVV AEIADRVAVM QGGRLVEAGP       240
     AREVLHHPQD PYTRMLIAAV PSATPPPPRQ RPAAQAPVLT VRDLEKTYGG SLFSRAGRHV       300
     RALDGVSLAL KPGETLGIVG ESGSGKSTLA RCIARFVDPS SGEIRLDGTD IARLSDRALH       360
     PYRRRVQVIF QDPYRSLNPR RTVGQSITEG PRNYGMARDE ALARARRLIG LVGLDADALD       420
     RFPHEFSGGQ RQRIAIARAL AMEPDLLIAD EAVSALDVSV QAQVLDLLEE VRERLNLAIL       480
     FITHDLRVAA RLCDHLIVML NGRVVEEGET AALFSDPRHD YTKALFAAAP GASALRPEAG       540
     PRAANAAPPQ                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page