(data stored in ACNUC7421 zone)

EMBL: CP001349.PE394

CP001349.PE394       Location/Qualifiers
FT   CDS             complement(451314..451883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55446"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB53"
FT                   /inference="similar to AA sequence:KEGG:M446_0094"
FT                   /protein_id="ACL55446.1"
FT                   /translation="MRTGSGAHPPVEGARGRRTSRVPHGLRFVRHRSAILIALALLTVP
FT                   PGSAPARVLSDGDLASVARIKPLFVDVLNDVSQSAQRADLSGADSDCLRSTLRALLQIS
FT                   EELKGYESLITIEGELVDFGDDATLKSVLRFAVENALKILDIERRRLGELSDQCARYPL
FT                   SAAKTRQALQFIDSTQAILRAVQPRL"
     MRTGSGAHPP VEGARGRRTS RVPHGLRFVR HRSAILIALA LLTVPPGSAP ARVLSDGDLA        60
     SVARIKPLFV DVLNDVSQSA QRADLSGADS DCLRSTLRAL LQISEELKGY ESLITIEGEL       120
     VDFGDDATLK SVLRFAVENA LKILDIERRR LGELSDQCAR YPLSAAKTRQ ALQFIDSTQA       180
     ILRAVQPRL                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page