(data stored in ACNUC7421 zone)

EMBL: CP001349.PE395

CP001349.PE395       Location/Qualifiers
FT   CDS             452077..453345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0405"
FT                   /product="membrane-fusion protein"
FT                   /note="KEGG: met:M446_0093 membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55447"
FT                   /db_xref="GOA:B8IB54"
FT                   /db_xref="InterPro:IPR022275"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB54"
FT                   /inference="similar to AA sequence:KEGG:M446_0093"
FT                   /protein_id="ACL55447.1"
FT                   /translation="MSPSPQRTFRAISLERASSPEQLDHLVRITKPADWILGAVIALLL
FT                   TTALTWSVVGRIPTRAAGEGILVSVGGRVVDAVSATAGRLATIEVAVGDRVAQGQTVAR
FT                   IAQTEIEQRYRNAVEVHREREREHTTLKAKTESELAAKARNFAKLEEAFTQIVQATEQR
FT                   IDYLAGEVKNLEMLLSKGITTRRIVEDRRRELTDARQRRQDAQNEVLKLRSQKADLETQ
FT                   RERDIQDSEFRLNEARRQMEQLAGELGRNTQVTSPIEGRVLEIKVSPGSVLSVGTPVIA
FT                   VETEGKALEAVIYIPADKGKAVKPGMETRLEPSTVKREEFGTLVGTVVSISDFPITPQG
FT                   MAAVLHNDSLVTRFSQEGAPYAALVRLQPDPGTASGYRWAVGKGPDLRLTSGTLTKAEI
FT                   TTREQRPLDLVVPMLKRLTGLAG"
     MSPSPQRTFR AISLERASSP EQLDHLVRIT KPADWILGAV IALLLTTALT WSVVGRIPTR        60
     AAGEGILVSV GGRVVDAVSA TAGRLATIEV AVGDRVAQGQ TVARIAQTEI EQRYRNAVEV       120
     HREREREHTT LKAKTESELA AKARNFAKLE EAFTQIVQAT EQRIDYLAGE VKNLEMLLSK       180
     GITTRRIVED RRRELTDARQ RRQDAQNEVL KLRSQKADLE TQRERDIQDS EFRLNEARRQ       240
     MEQLAGELGR NTQVTSPIEG RVLEIKVSPG SVLSVGTPVI AVETEGKALE AVIYIPADKG       300
     KAVKPGMETR LEPSTVKREE FGTLVGTVVS ISDFPITPQG MAAVLHNDSL VTRFSQEGAP       360
     YAALVRLQPD PGTASGYRWA VGKGPDLRLT SGTLTKAEIT TREQRPLDLV VPMLKRLTGL       420
     AG                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page