(data stored in ACNUC7421 zone)

EMBL: CP001349.PE396

CP001349.PE396       Location/Qualifiers
FT   CDS             453352..455529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0406"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; peptidase C39 bacteriocin processing;
FT                   SMART: AAA ATPase; KEGG: met:M446_0092 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55448"
FT                   /db_xref="GOA:B8IB55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022514"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB55"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55448.1"
FT                   /translation="MRLAGLLRSLGARASVKATPTVLQMEAVECGAAALAMVLAHHGAW
FT                   VPLEQLRIACGVSRDGSKASNIVKAARRFGLAAKGFRKEPATLHELPMPCILHWNFNHF
FT                   VVLEGIRGDHAFINDPAMGRRRITMTELDLAFTGVALAMEPTDEFRRLGRKPQGLLLLL
FT                   RELRFSRAAVGLVVGVSLALIVPGILIPGFTKVFVDEVLIQNSKGWLVPLLIGMGLTAL
FT                   FRAGVTALQLSLTLRLQTKLAVVMTSRFLWHVLALPMEFFAQRHAGDIANRVATNEEIA
FT                   RLLSGGVVSNALSLTSLVFFAAAMAVYDGLLAAIGVTLSLLNVLALRLIAGRREDLSRS
FT                   LALERGKLLGSTISAVRTIETLKASGLEDEAFAQWAGIQAKALNAEQELGAASTLLEAV
FT                   PTLISGLTLAAILGIGGLRVIEGSLTLGGLVAFQSLMASFSEPITALVNQIGSIQTIKG
FT                   GLERLEDVYNYPVDHPAPEPESEPLPPKLVGRVELRDVSFGYAILEPPLLADLSITIEP
FT                   GTRLALVGLSGSGKSTLGRLICGLLKPWSGEVRIDGRRLDAIPPEVFANSVAYVDQDVV
FT                   LFEGTARDNLTLWDPTVAEPDLSLALKDAAIHGEIATRPGNYDCRVVEGGTNFSGGQRQ
FT                   RIEIARALVANPSVIVLDEATAALDPVTEKAIDDNLRRRGCTCIIIAHRLSTIRDCDEI
FT                   IVLEQGRIVERGTHEQLIARAGAYAHLVAQQ"
     MRLAGLLRSL GARASVKATP TVLQMEAVEC GAAALAMVLA HHGAWVPLEQ LRIACGVSRD        60
     GSKASNIVKA ARRFGLAAKG FRKEPATLHE LPMPCILHWN FNHFVVLEGI RGDHAFINDP       120
     AMGRRRITMT ELDLAFTGVA LAMEPTDEFR RLGRKPQGLL LLLRELRFSR AAVGLVVGVS       180
     LALIVPGILI PGFTKVFVDE VLIQNSKGWL VPLLIGMGLT ALFRAGVTAL QLSLTLRLQT       240
     KLAVVMTSRF LWHVLALPME FFAQRHAGDI ANRVATNEEI ARLLSGGVVS NALSLTSLVF       300
     FAAAMAVYDG LLAAIGVTLS LLNVLALRLI AGRREDLSRS LALERGKLLG STISAVRTIE       360
     TLKASGLEDE AFAQWAGIQA KALNAEQELG AASTLLEAVP TLISGLTLAA ILGIGGLRVI       420
     EGSLTLGGLV AFQSLMASFS EPITALVNQI GSIQTIKGGL ERLEDVYNYP VDHPAPEPES       480
     EPLPPKLVGR VELRDVSFGY AILEPPLLAD LSITIEPGTR LALVGLSGSG KSTLGRLICG       540
     LLKPWSGEVR IDGRRLDAIP PEVFANSVAY VDQDVVLFEG TARDNLTLWD PTVAEPDLSL       600
     ALKDAAIHGE IATRPGNYDC RVVEGGTNFS GGQRQRIEIA RALVANPSVI VLDEATAALD       660
     PVTEKAIDDN LRRRGCTCII IAHRLSTIRD CDEIIVLEQG RIVERGTHEQ LIARAGAYAH       720
     LVAQQ                                                                   725
//

If you have problems or comments...

PBIL Back to PBIL home page