(data stored in ACNUC7421 zone)

EMBL: CP001349.PE397

CP001349.PE397       Location/Qualifiers
FT   CDS             455526..458420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0407"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_0091 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55449"
FT                   /db_xref="GOA:B8IB56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022515"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB56"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55449.1"
FT                   /translation="MTEARTRQPGGLALVEEALPPPQVILDGRHPVRLGRADRLLQVVL
FT                   GHADLFAVRHAAGGVAGPRRHLLRIESGGLIPPIPEAAGEGGERLEIIAVGTPGTEARI
FT                   VAREAWARRDLVEAWIARLAGVIAGSHPSWDIREAEGGAEALEPGERRRGPARALRWVA
FT                   VEAGTGRLLGREPALGPGGLPLPLAAGLWIEAGPDGCRLAASAGPEDDRLWEALDCFHH
FT                   CAVAALHEAATGEEAREAQRLARRSELDAVRSAELFGRLSGIVARRPEQSRPSVDPDDP
FT                   LLSACTILAETIPAPIVRPPGRRRTAQDFVAVVEIARASRLRVRRTLLRGTWWREDVGP
FT                   LLGWHGEAGDPVALVRDRRGYVMTNPAAGTRRRVDAALAAELAVEAASFYPTLPARALT
FT                   LRDLLAFALRRARGTIAGIVLPAVVLGLLALVSPLITQALVNSAIPRSELDQLTVCAIA
FT                   LAVTAIAAAAVQALEGLAVLRLEGLIDWTLQAAMIDRLLRLRAGLFRDYTVGDLVDRAM
FT                   GIDAVRRLLTGRTLRSLLAGVFCWFSIGLMLVYDVTLALIAVALALLRGLLILAASALR
FT                   LYHESRHFDGQGRVAGFVLQLFAGIGKLRVAHAGVRALAVWSQLFATQKGHFLAAQRIG
FT                   NGLAVVETAFPTFATLAIFAAASALGSTLTQNLGAFLAFFAAFGQTMAGIGLWASGISE
FT                   ALVAIPHVTRMRPLVAAEAEIADDRKPPGELAGAIELSRVTFRYAPFGPPVLDTVSLRI
FT                   APGEYVAIVGPSGSGKSSLFRLLLGFETPESGAVFYDGKALDTLDVSALRRQLGVVLQN
FT                   GRLATGSLYENICGGVPLPLDQAWEAARLAGLEADIRAMPMGLQTVVAEGVNTLSGGQR
FT                   QRVLIARAIARRPRILLLDEATSALDNRSQAVVSASLGALNVTRLVIAHRLSTVREADR
FT                   IVVLAEGRIVQTGTFDELIAAPGLFAEFAQRQLL"
     MTEARTRQPG GLALVEEALP PPQVILDGRH PVRLGRADRL LQVVLGHADL FAVRHAAGGV        60
     AGPRRHLLRI ESGGLIPPIP EAAGEGGERL EIIAVGTPGT EARIVAREAW ARRDLVEAWI       120
     ARLAGVIAGS HPSWDIREAE GGAEALEPGE RRRGPARALR WVAVEAGTGR LLGREPALGP       180
     GGLPLPLAAG LWIEAGPDGC RLAASAGPED DRLWEALDCF HHCAVAALHE AATGEEAREA       240
     QRLARRSELD AVRSAELFGR LSGIVARRPE QSRPSVDPDD PLLSACTILA ETIPAPIVRP       300
     PGRRRTAQDF VAVVEIARAS RLRVRRTLLR GTWWREDVGP LLGWHGEAGD PVALVRDRRG       360
     YVMTNPAAGT RRRVDAALAA ELAVEAASFY PTLPARALTL RDLLAFALRR ARGTIAGIVL       420
     PAVVLGLLAL VSPLITQALV NSAIPRSELD QLTVCAIALA VTAIAAAAVQ ALEGLAVLRL       480
     EGLIDWTLQA AMIDRLLRLR AGLFRDYTVG DLVDRAMGID AVRRLLTGRT LRSLLAGVFC       540
     WFSIGLMLVY DVTLALIAVA LALLRGLLIL AASALRLYHE SRHFDGQGRV AGFVLQLFAG       600
     IGKLRVAHAG VRALAVWSQL FATQKGHFLA AQRIGNGLAV VETAFPTFAT LAIFAAASAL       660
     GSTLTQNLGA FLAFFAAFGQ TMAGIGLWAS GISEALVAIP HVTRMRPLVA AEAEIADDRK       720
     PPGELAGAIE LSRVTFRYAP FGPPVLDTVS LRIAPGEYVA IVGPSGSGKS SLFRLLLGFE       780
     TPESGAVFYD GKALDTLDVS ALRRQLGVVL QNGRLATGSL YENICGGVPL PLDQAWEAAR       840
     LAGLEADIRA MPMGLQTVVA EGVNTLSGGQ RQRVLIARAI ARRPRILLLD EATSALDNRS       900
     QAVVSASLGA LNVTRLVIAH RLSTVREADR IVVLAEGRIV QTGTFDELIA APGLFAEFAQ       960
     RQLL                                                                    964
//

If you have problems or comments...

PBIL Back to PBIL home page